[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55306.1
DDBJ      :             putative secreted cellulose-binding protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  60/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
b.1.18
:222 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   37->220 2bemA PDBj 7e-08 33.8 %
:RPS:PDB   37->221 2benB PDBj 2e-28 26.9 %
:RPS:SCOP  37->221 2bemA  b.1.18.2 * 1e-33 26.2 %
:HMM:SCOP  37->223 2bemA_ b.1.18.2 * 8.7e-44 37.1 %
:RPS:PFM   37->220 PF03067 * Chitin_bind_3 8e-12 38.3 %
:HMM:PFM   37->220 PF03067 * Chitin_bind_3 1.9e-41 33.3 168/183  
:BLT:SWISS 26->221 GBPA_SHEON 1e-09 29.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55306.1 GT:GENE AAZ55306.1 GT:PRODUCT putative secreted cellulose-binding protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(1472705..1473373) GB:FROM 1472705 GB:TO 1473373 GB:DIRECTION - GB:PRODUCT putative secreted cellulose-binding protein GB:PROTEIN_ID AAZ55306.1 GB:DB_XREF GI:71915404 LENGTH 222 SQ:AASEQ MHRYSRTGKHRWTVRALAVLFTALLGLTQWTAPASAHGSVINPATRNYGCWLRWGHDHLNPNMQYEDPMCWQAWQDNPNAMWNWNGLYRDWVGGNHRAALPDGQLCSGGLTEGGRYRSMDAVGPWKTTDVNNTFTIHLYDQASHGADYFLVYVTKQGFDPTTQPLTWDSLELVHQTGSYPPAQNIQFTVHAPNRSGRHVVFTIWKASHMDQTYYLCSDVNFV GT:EXON 1|1-222:0| BL:SWS:NREP 1 BL:SWS:REP 26->221|GBPA_SHEON|1e-09|29.8|171/475| BL:PDB:NREP 1 BL:PDB:REP 37->220|2bemA|7e-08|33.8|154/170| RP:PDB:NREP 1 RP:PDB:REP 37->221|2benB|2e-28|26.9|160/169| RP:PFM:NREP 1 RP:PFM:REP 37->220|PF03067|8e-12|38.3|162/174|Chitin_bind_3| HM:PFM:NREP 1 HM:PFM:REP 37->220|PF03067|1.9e-41|33.3|168/183|Chitin_bind_3| GO:PFM:NREP 1 GO:PFM GO:0019028|"GO:viral capsid"|PF03067|IPR004302| RP:SCP:NREP 1 RP:SCP:REP 37->221|2bemA|1e-33|26.2|160/170|b.1.18.2| HM:SCP:REP 37->223|2bemA_|8.7e-44|37.1|159/0|b.1.18.2|1/1|E set domains| OP:NHOMO 81 OP:NHOMOORG 63 OP:PATTERN ---------------------------1---------------------------------------- ----1-------------------------------------------1--------1--11--3-23342-------------------------------------------------------------------------1--------------------------------------------------------------1-11------1----1--------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111----1111-1------------------------------4------------------------------------------1-----------------------------------------------------------1--------------------------------------------------------------------------1----------11111111111----------1---------------------------------11121------------------------11-11111-1-1122----------------------------------------------------------------------- ----2-------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 184 STR:RPRED 82.9 SQ:SECSTR ####################################cEEEEETccHHHHHHTTcccc#cccGGGGccccccGGGGGcGGGcEEEccTTTcccccTTTccccTTcTTTTTccTcGGGGGGGcccTcccEEEcEEEEEEEEEcccccEEEEEEEEccTTccTTTccccTTTccccccEEEEccccEEEEEEEEcTccEEEEEEEEEEETTccEEEEEEEEEEE# DISOP:02AL 1-8| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEccHHHHHHHHHHcccccccccccccccHHHHHHHHccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccEEEEEEEEEcccccEEEEEEEccccccccccccHHHccccccccccccccEEEEEEEcccccccEEEEEEEEEEcccccEEEEEEEEEc //