[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55328.1
DDBJ      :             similar to ABC-type branched-chain amino acid transport systems periplasmic component
Swiss-Prot:             

Homologs  Archaea  16/68 : Bacteria  409/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
c.93.1
:392 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   53->366 3hutA PDBj 6e-15 26.1 %
:RPS:PDB   46->387 3ckmA PDBj 3e-29 15.8 %
:RPS:SCOP  43->371 1usgA  c.93.1.1 * 4e-51 22.0 %
:HMM:SCOP  44->387 1qo0A_ c.93.1.1 * 3e-66 29.9 %
:RPS:PFM   69->372 PF01094 * ANF_receptor 8e-21 34.0 %
:HMM:PFM   66->371 PF01094 * ANF_receptor 2e-26 21.5 302/348  
:BLT:SWISS 45->392 LIVB7_BRUAB 2e-21 25.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55328.1 GT:GENE AAZ55328.1 GT:PRODUCT similar to ABC-type branched-chain amino acid transport systems periplasmic component GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1497370..1498548 GB:FROM 1497370 GB:TO 1498548 GB:DIRECTION + GB:PRODUCT similar to ABC-type branched-chain amino acid transport systems periplasmic component GB:PROTEIN_ID AAZ55328.1 GB:DB_XREF GI:71915426 InterPro:IPR000709 LENGTH 392 SQ:AASEQ MNMRKSWSRTLLAATGATALLAAAACGTNEAGESSSTGEGLPDTIKIMSIKEMTGPVSFAGENSTKGIDLAVEQINEQGFLGDTKLEIDLKDASDSTQEAASLATQAVSDKSYSAILGPGLSSQASAISPIAEKGEIPVIYYQAGSDGVLVGDYTYRVTAPAASYYHIIGDYLAEKKVKTAAVLYTSGNPTLTELGEKAVPGVIEENGVTIKRSDTVSNDTQDFTAVTSEIIKADPDAVFLLLLGPQNPRAVSQLKQKGYDGEIIGMTTMGAGNLETAGEDAAGVVWPSNFSARSEVPSTQEFVKAYEEKYGELPNNYAAEGYDAVWLLARGIKEANSADRVAIREGIAKVAAEGFDGAQGPLSFENNDVRVEGVIASWNGSEEVVVTLGDD GT:EXON 1|1-392:0| BL:SWS:NREP 1 BL:SWS:REP 45->392|LIVB7_BRUAB|2e-21|25.7|338/399| SEG 10->28|tllaatgatallaaaacgt| BL:PDB:NREP 1 BL:PDB:REP 53->366|3hutA|6e-15|26.1|303/341| RP:PDB:NREP 1 RP:PDB:REP 46->387|3ckmA|3e-29|15.8|304/309| RP:PFM:NREP 1 RP:PFM:REP 69->372|PF01094|8e-21|34.0|285/319|ANF_receptor| HM:PFM:NREP 1 HM:PFM:REP 66->371|PF01094|2e-26|21.5|302/348|ANF_receptor| RP:SCP:NREP 1 RP:SCP:REP 43->371|1usgA|4e-51|22.0|323/345|c.93.1.1| HM:SCP:REP 44->387|1qo0A_|3e-66|29.9|338/0|c.93.1.1|1/1|Periplasmic binding protein-like I| OP:NHOMO 1109 OP:NHOMOORG 429 OP:PATTERN 11--------------1-21123-2---2-13-----------1-1-2----------------1--- -------1111---1------3---2------2222111111-21----1--1-----11324-2-211-222223111---2--------------------------------------------1-11--3--1---1---24-1141121111------1-21111-------------4221-11--------------------1--------4311--------31------------------------11-----11--11---11-------1---11111111111111-------------1111111111221-41111111-1---------2-1--4--62233372--11---3-12--------1111-1ECA1-13576333453543536-337218291-1-722122464422371--212-111413--------5---15-2-----------------------------2-----5C99A98BACA43332BBD8444424CAE5755-3545615347BC4FI135-1-143----------55A156-127237533413332152-2333322-A---1-222221----------11----111-21------------------------------1------2-2--2-1111111111-111111111111-111111222--11-211222122221212111111111--111111111111--------------1112-------------------------1111111311311111312--------------------------------------------------------1---------------------------1-2--13111-2- --------------------------------------------------------------------------------------------------------------------------------------------------------------2--------------------------1--1-1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 350 STR:RPRED 89.3 SQ:SECSTR #####################################EEEEccEEcEEEEEccccTTHHHHHHHHHHHHHHHTHHHHHcEEcTccccEEEEETTccHHHHHHHHHHTTccTcccEEEccccHHHHHHHHHcGGGGTTEEEEccccTTGccccTTEEEccccHHHHHHHHHHHHHHHTTccccEEEEcTccHHHHHHHHHHHHHHHHHHccccEEEEEccTTHHHHHHHHHHccTTccEEEEccccHHHHHHHHHHTTTcTTcEEEEcGccHHHHTcHHHHHHTTcEEEEGGGGccccHHHHHHHHHTTTcHHHGccHHHHHHHHHHHHHHTHHHTccHHHHHHHHHHHHHcTTccEEETTEEEEEcTTccEEEEEEEEEETTEEEEc##### DISOP:02AL 1-10| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEccccHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHcccEEEEEcccccccccccEEEEEcccHHHHHHHHHHHHHHHcccEEEEEEEEccccccHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHccEEEEEccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccEEEEEEcccccEEccEEEEEEccEEEEEEcccc //