[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55332.1
DDBJ      :             ABC-type branched-chain amino acid transport systems ATPase component
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  903/915 : Eukaryota  189/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:238 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   1->234 1ji0A PDBj 2e-45 44.7 %
:RPS:PDB   2->201 2dwoA PDBj 2e-32 10.4 %
:RPS:SCOP  1->233 1b0uA  c.37.1.12 * 1e-38 26.6 %
:HMM:SCOP  1->237 1g6hA_ c.37.1.12 * 3.2e-54 35.6 %
:RPS:PFM   41->161 PF00005 * ABC_tran 1e-11 37.9 %
:HMM:PFM   41->161 PF00005 * ABC_tran 3.9e-15 27.4 117/118  
:HMM:PFM   20->46 PF01580 * FtsK_SpoIIIE 0.00018 37.0 27/205  
:BLT:SWISS 1->232 LIVF_SALTY 8e-53 43.5 %
:PROS 134->148|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55332.1 GT:GENE AAZ55332.1 GT:PRODUCT ABC-type branched-chain amino acid transport systems ATPase component GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1501244..1501960 GB:FROM 1501244 GB:TO 1501960 GB:DIRECTION + GB:PRODUCT ABC-type branched-chain amino acid transport systems ATPase component GB:PROTEIN_ID AAZ55332.1 GB:DB_XREF GI:71915430 InterPro:IPR001687 InterPro:IPR003439 InterPro:IPR003593 LENGTH 238 SQ:AASEQ MLEIRDLHVSYGKIEAVRGVSASASPGRITLVLGANGAGKTTTLRAAMGLLPVRSGEVLLDGKPITGRPTHRIVRDGLVLVPEGRQVFAPLTVEENLILGGYTVSKEKAAETMEQVYEMFPILKERRNGPAGLLSGGEQQMLAFGRALMSSPRAMMLDEPSMGLAPTMVESVLSSVRSIADSGIALLMVEQNAEMGLEIADDVVVVARGEVVFSGPAEQARQNSSVVRAFLGEAALSS GT:EXON 1|1-238:0| BL:SWS:NREP 1 BL:SWS:REP 1->232|LIVF_SALTY|8e-53|43.5|232/237| PROS 134->148|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 203->212|vvvvargevv| BL:PDB:NREP 1 BL:PDB:REP 1->234|1ji0A|2e-45|44.7|226/231| RP:PDB:NREP 1 RP:PDB:REP 2->201|2dwoA|2e-32|10.4|183/449| RP:PFM:NREP 1 RP:PFM:REP 41->161|PF00005|1e-11|37.9|116/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 41->161|PF00005|3.9e-15|27.4|117/118|ABC_tran| HM:PFM:REP 20->46|PF01580|0.00018|37.0|27/205|FtsK_SpoIIIE| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 1->233|1b0uA|1e-38|26.6|233/258|c.37.1.12| HM:SCP:REP 1->237|1g6hA_|3.2e-54|35.6|236/254|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 33298 OP:NHOMOORG 1160 OP:PATTERN PPC6IH9AIJIEIFLFb9LIHKLSmHKSaLVSB5BA95BBDA8JSJRaFHoYO6ITFKQJICDBW185 EJYI*SOYdcbQSKOJJIH-HZ88R*IHIIIIfgfhg***P*P*jnbUeTPJusoJIX66iczO*jo***VPONNgMLOEeUb76A79EDD82BACA--BDGGDESCPDF444444477655559IFCFMEGKMPJZfelqDDGgSbQTcNNTTUKMFAECAERTPVjmoPCKCCBACIADB9eTRROQR6NWfuuvsvsv*jzzytv*tljjel*zyShnulVbddccdc**INNNNNMKNNNNNLMKHHFIcPQOecNKMHQcaHIefNLILaRKQOedggcbhcccdfehadcjdfdUTVUSUUUVUUTTeYaSQQcbdbYybq*wwwyzvrVtXcqllPRTR*USWPyPWMH**ZWQSWOKTYObZKPMOIVMMMFCEDFFTL***RFd*y***twrwuoxsrr*-Wb*TP*Wu**K8**************FBHvw**x***q*LLLLLLLLkRSDLbNn54423222313345454454364467265H7AABDr**v*******jjjli****vptsbw***rz*o9HqqgtWfad******NbSENDGRLBBAAA9AJIHRfZSr*KQNjWTcgSTbDXQVKNSWNLMSRMYkNs9EAFABBBBB92522222227F88ADBVUkDjMKDJBbHHJLKENKJIJJJJKHKIJ4-6BHEJ11----rj*vMtffllfgieide-jeefhehfgfkifacecbf*****RVOWVUVVXWWYXVVXVVU*ZXVccabI3u******zz***32CB9A999CBFDFHmb*NMNUQPBHJHFNKOQHIKHIAKCHIYPccaakvt*euumgXyxz799687989DNSSfVXWXWYbdaaEGDAABA8BA789844GKCCCABD56535333h7J43334-1-42643456536232111RadKJWpXbS7SI ----PMB-JC27DPGAA787DCAH7EC7745369A8766756744699BABAGA8776688721-1211-1125423-23-1113233-544A43533225178D94DABSDJGUPIBBB7AKFdg8g8**Z2aKaFBA6W8BUK9GA66Q76*DJIFg9K*BRES5XMM*OUH8B9C3v5859BSJNr7kQ56XLbYG ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 235-238| PSIPRED cEEEEEEEEEEccEEEEEcccEEEcccEEEEEEccccccHHHHHHHHHccccccccEEEEEcEEcccccHHHHHHHHccccccccEEcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccEEEEcccHHcccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHccHHHHHHHccHHHccc //