[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55363.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:291 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   234->282 PF11194 * DUF2825 9.8e-21 46.9 49/50  
:HMM:PFM   121->200 PF07336 * DUF1470 0.00076 22.5 80/132  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55363.1 GT:GENE AAZ55363.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1535581..1536456 GB:FROM 1535581 GB:TO 1536456 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ55363.1 GB:DB_XREF GI:71915461 LENGTH 291 SQ:AASEQ MGRKSSCYSAWWQCKPCSACLTGRLARWLPQGGSPVCLQALPRVPPAQLWGWALNYATRCHLLASGWVLLVRLARQEQAAAKRLVQPLPREPKKTPPTSPSFPLPLKSPPRPCLPQGQVGPPPPLQTPLLLQDLREVRQEAYRRQQVVPQQPVPPPPHPHLLGLLLRPRPPQQDRQEWSLRAQRREPRPPLKRLIQQPAQSLMQADFPIPPQRSIPTCVGSIPPARRGLPNRPVHPHVRGEHDSLSETAVLDVGPSPRAWGAYLIQQAGFWPVRSIPTCVGSMLEEATHER GT:EXON 1|1-291:0| SEG 89->134|prepkktpptspsfplplkspprpclpqgqvgpppplqtplllqdl| SEG 143->176|rrqqvvpqqpvpppphphllglllrprppqqdrq| HM:PFM:NREP 2 HM:PFM:REP 234->282|PF11194|9.8e-21|46.9|49/50|DUF2825| HM:PFM:REP 121->200|PF07336|0.00076|22.5|80/132|DUF1470| OP:NHOMO 15 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------F---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 85-101, 171-192, 283-291| PSIPRED ccccccHHHHHcccccHHHHHHHHHHHHccccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHEEcccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccEEEEEEEEEEcccccHHHHHHcccc //