[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55381.1
DDBJ      :             putative transport protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:374 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  17->373 1pv7A_ f.38.1.2 * 3.9e-24 23.1 %
:HMM:PFM   17->337 PF07690 * MFS_1 4.4e-19 25.1 315/353  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55381.1 GT:GENE AAZ55381.1 GT:PRODUCT putative transport protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1557427..1558551 GB:FROM 1557427 GB:TO 1558551 GB:DIRECTION + GB:PRODUCT putative transport protein GB:PROTEIN_ID AAZ55381.1 GB:DB_XREF GI:71915479 LENGTH 374 SQ:AASEQ MTWGVYAYAFFQDLIPLYPVYALLFADTGATDGQISALFALWTLVAFTFEVPSGLLADRWARRPLVAAAPLLAGAAFALWTLFPSFPVFAAGFVLWGAGGALGSGAFQALVYDTLAAAGRTSDYPRLIGRSRALATGAVLASGLLTGPLLLIGGYAAVGAASVAACVLAALAAGLLPETPRHRPVAGEQRQRGAWSGAWTRLRHTPALVGVMGALAALTVVDALDEYLPLLARATGAADWAVAPLVVLVSAGTALGQWCAGRGTRWTGPILCAGVLLLVAGALSGHPAGMVGVAAGFGAGAWAAVAVENRMHEQVSSRVRATVASLAEAGRSVVALLVYAAYGTGALWAGPGLLFALLVVPCLAVGVWLSVWRL GT:EXON 1|1-374:0| TM:NTM 11 TM:REGION 5->27| TM:REGION 35->57| TM:REGION 81->103| TM:REGION 132->154| TM:REGION 158->180| TM:REGION 203->225| TM:REGION 232->254| TM:REGION 264->286| TM:REGION 288->310| TM:REGION 320->342| TM:REGION 349->371| SEG 61->79|arrplvaaapllagaafal| SEG 97->106|gaggalgsga| SEG 140->176|lasglltgpllliggyaavgaasvaacvlaalaagll| SEG 207->225|alvgvmgalaaltvvdald| SEG 273->283|agvlllvagal| SEG 288->307|agmvgvaagfgagawaavav| HM:PFM:NREP 1 HM:PFM:REP 17->337|PF07690|4.4e-19|25.1|315/353|MFS_1| HM:SCP:REP 17->373|1pv7A_|3.9e-24|23.1|351/417|f.38.1.2|1/1|MFS general substrate transporter| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-1---------------------1-------1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 178-193| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //