[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55390.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:145 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   20->69 1a6qA PDBj 2e-04 14.6 %
:HMM:PFM   52->100 PF02518 * HATPase_c 4.5e-05 24.4 45/111  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55390.1 GT:GENE AAZ55390.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1568588..1569025 GB:FROM 1568588 GB:TO 1569025 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ55390.1 GB:DB_XREF GI:71915488 LENGTH 145 SQ:AASEQ MSMMPHHPPSAPSVKGVWPCRIYPGDLSHTSRVRAEIRADLAALPHLPAGLVDAVELCASEAFANAVEHTRSGQEGGRVVRSLTRPAHNRLRLAVVDDGTTDTTPRIPCERTAAEWVEAETGRGLLLIAALATGNPCTGNKRAGQ GT:EXON 1|1-145:0| SEG 1->13|msmmphhppsaps| RP:PDB:NREP 1 RP:PDB:REP 20->69|1a6qA|2e-04|14.6|48/363| HM:PFM:NREP 1 HM:PFM:REP 52->100|PF02518|4.5e-05|24.4|45/111|HATPase_c| OP:NHOMO 3 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------3---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 48 STR:RPRED 33.1 SQ:SECSTR ###################HHHccccccHHHHHHHHHHTTccccc##TTTGGGGGHHHHHHHHHHHccc############################################################################ DISOP:02AL 1-4, 6-7, 137-145| PSIPRED ccEEccccccccccccccHHHHccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEccccEEEEEEEEccccccccccccccccccccccccccHHHHHHHHHccccccccccccc //