Thermobifida fusca YX (tfus0)
Gene : AAZ55394.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:205 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55394.1 GT:GENE AAZ55394.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(1574049..1574666) GB:FROM 1574049 GB:TO 1574666 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ55394.1 GB:DB_XREF GI:71915492 LENGTH 205 SQ:AASEQ MVFPAPTRGLPRRTRGRCPGHGTLPGAKGVDGVLMGPVPGCPARARRGARPGRRGGRPPSGLMINAAKAANLPFSWGFRASSRPALSPTADCGSPPGWLVCLRLCLVRGFPHSGRRRCPPHDERMERGEDCELPSTLVASAYARALPQRQAWHCGAALWRPTTPASRWGRSLFLPCTCGSGSARVPLPGHTRQHRALHDQVLSGL GT:EXON 1|1-205:0| SEG 6->20|ptrglprrtrgrcpg| SEG 36->59|gpvpgcpararrgarpgrrggrpp| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 44-60, 119-129| PSIPRED ccccccccccccccccccccccccccccccccEEEccccccHHHHHcccccccccccccccEEEEcHHHcccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccHHHHHcccccccHHHHHHHHHHHHccHHHHHHHccHHccccccHHHHccEEEEEEEccccccccccccccHHHHHHHHHHHHcc //