[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55400.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:128 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   76->102 PF02238 * COX7a 0.00053 29.6 27/56  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55400.1 GT:GENE AAZ55400.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(1579456..1579842) GB:FROM 1579456 GB:TO 1579842 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ55400.1 GB:DB_XREF GI:71915498 LENGTH 128 SQ:AASEQ MTDTTSPALTGQPTNYPLGRLPVEIDPRRRAPEPDEVHHDALAPAPHRCPAAVATWSGWVELGRMTGFGEVAPLPGIWDELVINTAITLPIGVEAYAVYAIGAWMSLRRLSRGTRRFAAISGRRCVAE GT:EXON 1|1-128:0| TM:NTM 1 TM:REGION 84->106| HM:PFM:NREP 1 HM:PFM:REP 76->102|PF02238|0.00053|29.6|27/56|COX7a| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------1---1-1---1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccccccccccccccccccccccEEEcccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc //