[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55408.1
DDBJ      :             membrane protein, putative
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:232 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   52->89 PF11239 * DUF3040 0.00042 15.8 38/82  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55408.1 GT:GENE AAZ55408.1 GT:PRODUCT membrane protein, putative GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(1586665..1587363) GB:FROM 1586665 GB:TO 1587363 GB:DIRECTION - GB:PRODUCT membrane protein, putative GB:PROTEIN_ID AAZ55408.1 GB:DB_XREF GI:71915506 LENGTH 232 SQ:AASEQ MTANQLWVLIVLGIFHGFHPGMGWLLAVSRGLQERRRSAVVSALPLLALGHAASVALVAVAVTVTGAMTTSTVFSVAGAAILVVAGVWFLLGPLHRGHQHPANLSSWQLAVASFVMACAHGSGLMLLPVLAGQVEHSHVHAGHGHHGTAVVETADAGAAASTGHVDLWDATLLGLAATGVHTLAMLAATGLAALLVYEFFGVYAMRLRWVTMDRVWGVTLLAGGVFVLWGAW GT:EXON 1|1-232:0| TM:NTM 6 TM:REGION 7->29| TM:REGION 41->63| TM:REGION 72->94| TM:REGION 109->131| TM:REGION 174->196| TM:REGION 210->232| SEG 38->73|savvsalpllalghaasvalvavavtvtgamttstv| SEG 76->87|vagaailvvagv| SEG 134->165|vehshvhaghghhgtavvetadagaaastghv| SEG 183->195|lamlaatglaall| HM:PFM:NREP 1 HM:PFM:REP 52->89|PF11239|0.00042|15.8|38/82|DUF3040| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 232-233| PSIPRED ccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccccHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //