[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55435.1
DDBJ      :             regulatory protein, MerR
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  74/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.6.1
:264 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   114->172 3hh0C PDBj 4e-04 32.1 %
:RPS:PDB   112->185 3d70A PDBj 5e-11 22.2 %
:RPS:SCOP  108->169 1j9iA  a.6.1.5 * 2e-08 11.9 %
:HMM:SCOP  103->197 1q06A_ a.6.1.3 * 2.1e-09 27.0 %
:HMM:PFM   153->181 PF02645 * DegV 0.00039 27.6 29/211  
:BLT:SWISS 101->255 Y1861_MYCBO 1e-51 65.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55435.1 GT:GENE AAZ55435.1 GT:PRODUCT regulatory protein, MerR GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1619024..1619818 GB:FROM 1619024 GB:TO 1619818 GB:DIRECTION + GB:PRODUCT regulatory protein, MerR GB:PROTEIN_ID AAZ55435.1 GB:DB_XREF GI:71915533 InterPro:IPR000551 LENGTH 264 SQ:AASEQ MVDGRVHRQQTNVVHDAPTAVVDAAHAPAYRRGSEAACGVENKSCCLPIVRYRRRPGSRRFGVAGISGKQNASEYRRSPVRWTGEECLLCDEDVVGLPMNVGYRGPTACMAAGITYRQLDYWARTQLVEPSVTVPGSSPAHRLYSFRDILILKVVKRLLDTGISLQQIRTAVEHLRQRATADLAHITLMSDGVSVYECTSPDQVVDLLQGGQGMFGIALGRVWRELEGKLSELQGEPLTEQARIAMEAYPRDELAQRRRQRRTG GT:EXON 1|1-264:0| BL:SWS:NREP 1 BL:SWS:REP 101->255|Y1861_MYCBO|1e-51|65.1|152/225| SEG 51->60|ryrrrpgsrr| SEG 256->262|qrrrqrr| BL:PDB:NREP 1 BL:PDB:REP 114->172|3hh0C|4e-04|32.1|56/127| RP:PDB:NREP 1 RP:PDB:REP 112->185|3d70A|5e-11|22.2|72/276| HM:PFM:NREP 1 HM:PFM:REP 153->181|PF02645|0.00039|27.6|29/211|DegV| RP:SCP:NREP 1 RP:SCP:REP 108->169|1j9iA|2e-08|11.9|59/68|a.6.1.5| HM:SCP:REP 103->197|1q06A_|2.1e-09|27.0|89/127|a.6.1.3|1/1|Putative DNA-binding domain| OP:NHOMO 74 OP:NHOMOORG 74 OP:PATTERN -------------------------------------------------------------------- ----111111111111111-1111111111111111111111111111111111111111111111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 72 STR:RPRED 27.3 SQ:SECSTR ###############################################################################################################HTccHHHHHHHHHTTcccccEEcTTTc##cEEEcGGGGGHHHHHHHHHHHTccHHHHHHHTTccHHHHHHHHHH############################################################################### DISOP:02AL 1-7, 54-79, 255-257, 259-264| PSIPRED ccccHHHHHHHccHHcccHHHHHHHcccHHHcccccccccccccccccHHHHHccccccccccccccccccccccccccccccccEEEEEccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHcccEEEEEccHHHHHHHHHcccEEEEEEHHHHHHHHHHHHHHccccccccHHHHHcccccHHHHHHHHHHcccc //