[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55444.1
DDBJ      :             transcriptional regulator, GntR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  107/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:124 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->81 2di3B PDBj 4e-06 38.2 %
:RPS:PDB   15->80 1e2xA PDBj 1e-12 19.7 %
:RPS:SCOP  15->80 1e2xA1  a.4.5.6 * 1e-12 19.7 %
:HMM:SCOP  7->101 1v4rA1 a.4.5.6 * 5.1e-17 41.1 %
:RPS:PFM   17->79 PF00392 * GntR 4e-06 49.2 %
:HMM:PFM   16->79 PF00392 * GntR 1.2e-17 42.2 64/64  
:BLT:SWISS 6->80 YTRA_BACSU 6e-12 41.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55444.1 GT:GENE AAZ55444.1 GT:PRODUCT transcriptional regulator, GntR family GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1628865..1629239 GB:FROM 1628865 GB:TO 1629239 GB:DIRECTION + GB:PRODUCT transcriptional regulator, GntR family GB:PROTEIN_ID AAZ55444.1 GB:DB_XREF GI:71915542 InterPro:IPR000524 LENGTH 124 SQ:AASEQ MATDFVRIDPNSKVPPYEQIRAAVANAAASGRLPVGYKLPTVRALASELSVAVNTAARAYRELEQAGVVETRGRSGTFIAAGGDRQRAEALAAARRYAETVSRLGISQQEAVDIVRAAVENLTR GT:EXON 1|1-124:0| BL:SWS:NREP 1 BL:SWS:REP 6->80|YTRA_BACSU|6e-12|41.3|75/130| SEG 22->29|aavanaaa| SEG 85->98|rqraealaaarrya| BL:PDB:NREP 1 BL:PDB:REP 14->81|2di3B|4e-06|38.2|68/230| RP:PDB:NREP 1 RP:PDB:REP 15->80|1e2xA|1e-12|19.7|66/222| RP:PFM:NREP 1 RP:PFM:REP 17->79|PF00392|4e-06|49.2|59/64|GntR| HM:PFM:NREP 1 HM:PFM:REP 16->79|PF00392|1.2e-17|42.2|64/64|GntR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00392|IPR000524| GO:PFM GO:0005622|"GO:intracellular"|PF00392|IPR000524| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00392|IPR000524| RP:SCP:NREP 1 RP:SCP:REP 15->80|1e2xA1|1e-12|19.7|66/73|a.4.5.6| HM:SCP:REP 7->101|1v4rA1|5.1e-17|41.1|90/0|a.4.5.6|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 143 OP:NHOMOORG 107 OP:PATTERN -------------------------------------------------------------------- --1-1----------1111-11--1111111111111111-----1--111-122112----1-11112111------1-211------------------------------------------------------------------------------------1-1-------------1-------2-2222223332333323211111232---1---------1-------------------------------------------------------------------------------------------1-1-111111-1111-1111----2---------------1-1111------1------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1----------------------------------------------------------1------1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 84 STR:RPRED 67.7 SQ:SECSTR HHHHcccccccccccHHHHHHHHHHHHHHTTcccTTcccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEETTEEEEEccccc######################################## DISOP:02AL 83-102, 123-124| PSIPRED cccccccccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEccccEEEEccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcc //