[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55470.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  34/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.110.7
:149 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   51->131 1a0kA PDBj 5e-14 16.5 %
:RPS:SCOP  15->131 1skoB  d.110.7.1 * 1e-16 15.0 %
:HMM:SCOP  6->137 1j3wA_ d.110.7.1 * 3.1e-33 41.2 %
:RPS:PFM   49->106 PF03259 * Robl_LC7 1e-06 41.4 %
:HMM:PFM   17->107 PF03259 * Robl_LC7 3.2e-25 33.3 90/91  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55470.1 GT:GENE AAZ55470.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(1657368..1657817) GB:FROM 1657368 GB:TO 1657817 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ55470.1 GB:DB_XREF GI:71915568 LENGTH 149 SQ:AASEQ MTEQTTSTPRSTSSELNWLLSDLVSRTEGAREAVLLSADGLLLSASDGMDRERAERISAIASGFSSLARGASKQLGAAEVRQTVVEMDNVFLFVLSAGHGACLALVADSSCDVGLVAYEINRLVRQVGPHLSTLPRNRRPMQGRSAEGL GT:EXON 1|1-149:0| SEG 35->48|llsadglllsasdg| RP:PDB:NREP 1 RP:PDB:REP 51->131|1a0kA|5e-14|16.5|79/130| RP:PFM:NREP 1 RP:PFM:REP 49->106|PF03259|1e-06|41.4|58/90|Robl_LC7| HM:PFM:NREP 1 HM:PFM:REP 17->107|PF03259|3.2e-25|33.3|90/91|Robl_LC7| RP:SCP:NREP 1 RP:SCP:REP 15->131|1skoB|1e-16|15.0|113/116|d.110.7.1| HM:SCP:REP 6->137|1j3wA_|3.1e-33|41.2|131/0|d.110.7.1|1/1|Roadblock/LC7 domain| OP:NHOMO 106 OP:NHOMOORG 34 OP:PATTERN -------------------------------------------------------------------- ----4----------1111-1---1-111111-1116112-5352---1-----------64--565BA86---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 79 STR:RPRED 53.0 SQ:SECSTR ##################################################cccHHHHHHHHHHHHcTTccTTTcEEETTEEEEEEEEETTTEEEEEETTEEEEEEEEE##EETTccHHHHHHHHHHHHHHH################## DISOP:02AL 1-13, 137-149| PSIPRED cccccccccccccHHHHHHHHHHHHHcHHHEEEEEEEccccEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEcccEEEEEEcccccEEEEEEcccccHHHHHHHHHHHHHHHHHHccccccccccccccccccc //