[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55483.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.79.7
:116 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   23->52 3cypB PDBj 1e-05 6.7 %
:RPS:SCOP  19->54 1r1mA  d.79.7.1 * 4e-05 33.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55483.1 GT:GENE AAZ55483.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(1673347..1673697) GB:FROM 1673347 GB:TO 1673697 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ55483.1 GB:DB_XREF GI:71915581 LENGTH 116 SQ:AASEQ MERRGFLPYRLRGTSDGNTETIALHSDVMFEFDRADLTPEAEAVVRRTAETLEHKSTLITRREMFAKVCASFEARLIDVDLLAKSPPKVAVRHIAITCGRLHTSPRHAVAHQLEII GT:EXON 1|1-116:0| RP:PDB:NREP 1 RP:PDB:REP 23->52|3cypB|1e-05|6.7|30/129| RP:SCP:NREP 1 RP:SCP:REP 19->54|1r1mA|4e-05|33.3|36/140|d.79.7.1| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 34 STR:RPRED 29.3 SQ:SECSTR ##################HHHTccccEEcccTTcccccHHHHHHHHHHHHHH################################################################ DISOP:02AL 1-3| PSIPRED ccccccccEEEEccccccEEEEEEEHHEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEccccHHHHHHHHHHHHcccccccHHHHHHHEEcc //