[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55492.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:129 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   14->108 PF10025 * DUF2267 6e-04 32.6 %
:HMM:PFM   14->109 PF10025 * DUF2267 1.6e-12 27.1 96/125  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55492.1 GT:GENE AAZ55492.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(1680776..1681165) GB:FROM 1680776 GB:TO 1681165 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ55492.1 GB:DB_XREF GI:71915590 LENGTH 129 SQ:AASEQ MPPPRRGETSLIAHQDLVDRVAAHEEIADTEEAQRVVHAVITSLSPHLAPEARKDLRRELPKSLWEDMDRGQAVSPQRSGTLAQQVGEELNCPPERGLQLARVVVSELSLASPILGREIADSLPDTFGS GT:EXON 1|1-129:0| RP:PFM:NREP 1 RP:PFM:REP 14->108|PF10025|6e-04|32.6|95/125|DUF2267| HM:PFM:NREP 1 HM:PFM:REP 14->109|PF10025|1.6e-12|27.1|96/125|DUF2267| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 75-81| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccc //