[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55506.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:153 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   42->75 3d9rD PDBj 8e-05 47.1 %
:RPS:PDB   28->138 3b8lB PDBj 2e-12 20.6 %
:RPS:SCOP  28->141 3ebyA1  d.17.4.4 * 7e-10 19.3 %
:HMM:SCOP  15->141 2bmoB1 d.17.4.4 * 6.8e-18 29.1 %
:HMM:PFM   26->77 PF02136 * NTF2 6.8e-06 34.6 52/118  
:HMM:PFM   75->142 PF00866 * Ring_hydroxyl_B 0.00034 23.5 68/145  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55506.1 GT:GENE AAZ55506.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(1699216..1699677) GB:FROM 1699216 GB:TO 1699677 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ55506.1 GB:DB_XREF GI:71915604 LENGTH 153 SQ:AASEQ MTAADPTLHTLVERLRRLEEMEIARNHLHRYAATLDNPTPEAVAALFTDDGILRTGRGTAVGRTSIADFYRRLLERDPSEKRHFITSPHTTWLAPGLVEIASYFLFTGRGTNRSVLGWGTYLDRIRIVDGTPLIAEKTIELHVGTDLHTGWPA GT:EXON 1|1-153:0| SEG 8->25|lhtlverlrrleemeiar| BL:PDB:NREP 1 BL:PDB:REP 42->75|3d9rD|8e-05|47.1|34/128| RP:PDB:NREP 1 RP:PDB:REP 28->138|3b8lB|2e-12|20.6|107/137| HM:PFM:NREP 2 HM:PFM:REP 26->77|PF02136|6.8e-06|34.6|52/118|NTF2| HM:PFM:REP 75->142|PF00866|0.00034|23.5|68/145|Ring_hydroxyl_B| RP:SCP:NREP 1 RP:SCP:REP 28->141|3ebyA1|7e-10|19.3|114/153|d.17.4.4| HM:SCP:REP 15->141|2bmoB1|6.8e-18|29.1|127/0|d.17.4.4|1/1|NTF2-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 153 STR:RPRED 100.0 SQ:SECSTR ccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHTTccHHHHHTTEEEEEEEEcTcccEEHHHHHHHHHHHHHHHEEcEEEEEEEEEEEEEEcccEEEEEEEEEEEEEETccEEEEEEEEEEEEEEETTEEEEEEEEEEEcccHHHHHHHHH DISOP:02AL 1-4| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccEEEccccccccHHHHHHHHHHHHHccccccccEEcccccHHHcccHHHHHHHHHHccccccccEEEHHHHHcEEEEEcccccEEEEEEEEEEcccccccccc //