[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55519.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  37/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:152 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->132 1q6wG PDBj 2e-05 26.8 %
:RPS:PDB   6->140 2bi0A PDBj 1e-12 14.1 %
:RPS:SCOP  10->147 1q6wA  d.38.1.4 * 3e-21 24.6 %
:HMM:SCOP  4->149 2bi0A1 d.38.1.4 * 3.3e-25 29.5 %
:RPS:PFM   16->119 PF01575 * MaoC_dehydratas 2e-07 35.9 %
:HMM:PFM   25->127 PF01575 * MaoC_dehydratas 1.4e-11 24.5 102/123  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55519.1 GT:GENE AAZ55519.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1713279..1713737 GB:FROM 1713279 GB:TO 1713737 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ55519.1 GB:DB_XREF GI:71915617 LENGTH 152 SQ:AASEQ MTNPLMHQRYFEDVTVGEELPSVAYPLTVYRMVMAAGATRDFNSIHHNTEYAQSTGAKEMYANTSFLLGTWERCVRDWIGPAGTIRSIRGFRMRAFNYVGDTVRVSATVTGTRVEDEVGVVELTIRSENSSGVSVGPGTVEVTLPRRGEEQE GT:EXON 1|1-152:0| BL:PDB:NREP 1 BL:PDB:REP 10->132|1q6wG|2e-05|26.8|123/147| RP:PDB:NREP 1 RP:PDB:REP 6->140|2bi0A|1e-12|14.1|135/327| RP:PFM:NREP 1 RP:PFM:REP 16->119|PF01575|2e-07|35.9|103/116|MaoC_dehydratas| HM:PFM:NREP 1 HM:PFM:REP 25->127|PF01575|1.4e-11|24.5|102/123|MaoC_dehydratas| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF01575|IPR002539| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01575|IPR002539| RP:SCP:NREP 1 RP:SCP:REP 10->147|1q6wA|3e-21|24.6|138/151|d.38.1.4| HM:SCP:REP 4->149|2bi0A1|3.3e-25|29.5|146/0|d.38.1.4|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 69 OP:NHOMOORG 38 OP:PATTERN -------------------------------------------------------------------- ----3---------25411-11--3111111313431323--1-------------------2----2121------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--------------------------------1-----------------------------------------2--------------------------1---------------------------------------1--------1------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 139 STR:RPRED 91.4 SQ:SECSTR #####TTcccGGGccTTcEEccccEEccHHHHHHHHHHHccccHHHHcHHHHHHHHcccccccHHHHHHHHHHHHTTTTTTccEEEEEEcEEccccccTTcEEEEEEEEEEEEEccccTTcccEEEEEEEEEEcTTccEEGGGc######## DISOP:02AL 144-145, 147-152| PSIPRED cccHHHHccEEEEEccccEEccccEEccHHHHHHHHHHHcccccEEccHHHHHHcccccccccHHHHHHHHHHHHHHHcccccEEEEEcccEEccccccccEEEEEEEEEEEEEccccEEEEEEEEEEEccccEEEEEEEEEEEEccccccc //