[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55527.1
DDBJ      :             putative ABC transporter, periplasmic iron-siderophore binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  166/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.92.2
:347 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   59->310 2wi8A PDBj 2e-08 24.8 %
:RPS:PDB   46->341 3eiwA PDBj 4e-33 16.0 %
:RPS:SCOP  51->322 2phzA1  c.92.2.4 * 3e-28 18.5 %
:HMM:SCOP  61->338 1efdN_ c.92.2.1 * 2.6e-47 29.3 %
:RPS:PFM   67->313 PF01497 * Peripla_BP_2 2e-09 29.1 %
:HMM:PFM   67->309 PF01497 * Peripla_BP_2 5.5e-27 23.3 227/238  
:BLT:SWISS 51->321 YFIY_BACSU 2e-13 31.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55527.1 GT:GENE AAZ55527.1 GT:PRODUCT putative ABC transporter, periplasmic iron-siderophore binding protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1723427..1724470 GB:FROM 1723427 GB:TO 1724470 GB:DIRECTION + GB:PRODUCT putative ABC transporter, periplasmic iron-siderophore binding protein GB:PROTEIN_ID AAZ55527.1 GB:DB_XREF GI:71915625 LENGTH 347 SQ:AASEQ MHSTLRTLPARLMSAGIAAAVILSLAACGGSSTDGGEDTAPSADGAFPVRIESALGVAEITEKPERIVTLGQGSAETAIALGTVPVGIESYEWGSDETGYLPWIYEAVTEAGEELPVQFTGGEDIDFETIIELEPDVILAPWSGITQEQYDILNDIAPTVAYPELPWTIEWDQQIEIIGQALGQSEEAQELIDDIERQFDEAAASRPEYAELTFSYIYTDGPGTLGVFMPHEQRVAMVSKLGLQVDPVVETLPETEGTASAVIGLENADKLKDSDLIFTFYTDAETRKEIESQELYASIPAIERGSVVVSEDTSFVTASSIINPLTVPWVLDRYLPLIDEAVAQLDR GT:EXON 1|1-347:0| BL:SWS:NREP 1 BL:SWS:REP 51->321|YFIY_BACSU|2e-13|31.6|244/325| BL:PDB:NREP 1 BL:PDB:REP 59->310|2wi8A|2e-08|24.8|230/283| RP:PDB:NREP 1 RP:PDB:REP 46->341|3eiwA|4e-33|16.0|282/292| RP:PFM:NREP 1 RP:PFM:REP 67->313|PF01497|2e-09|29.1|230/235|Peripla_BP_2| HM:PFM:NREP 1 HM:PFM:REP 67->309|PF01497|5.5e-27|23.3|227/238|Peripla_BP_2| GO:PFM:NREP 2 GO:PFM GO:0005381|"GO:iron ion transmembrane transporter activity"|PF01497|IPR002491| GO:PFM GO:0006827|"GO:high-affinity iron ion transport"|PF01497|IPR002491| RP:SCP:NREP 1 RP:SCP:REP 51->322|2phzA1|3e-28|18.5|259/277|c.92.2.4| HM:SCP:REP 61->338|1efdN_|2.6e-47|29.3|256/262|c.92.2.1|1/1|"Helical backbone" metal receptor| OP:NHOMO 284 OP:NHOMOORG 166 OP:PATTERN -------------------------------------------------------------------- -----41266732211111-11--1211111111111J5A-1-13-11211121111211----314-191-----------3------------------------------------------------------22-----2-3--111-----------12---8-----------------------2-11111211-12121334331111111133-2------53-11111111111111-----------------------------------------11111111111------------------------1112-------1-1-----111----------21----------1---------------------------------------1--------------11--------1------111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------11-1----------------------------11111111111---------------112--------------1---------------------------------------1----------1--------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 302 STR:RPRED 87.0 SQ:SECSTR #######################################cEEEEcccEEEEEETTEEEEEETTcccEEEccHHHHHHHHHTTccccEEccTTcGGGccHHHHHHHcccEEcccccEEcccccccccHHHHHHTcccEEEEcETTTTTTTHHHHHHHccEEEEccTTccHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHccccTTccEEEEEEEETTEEEEccTTcHHHHHHHHTTcccHHHHHTTGGGEETTEEEEcHHHHHHHHcccEEEEEccccHHHHHHHHcHHHHTcHHHHTTcEEEEEHHHHTTTccHHcHHHHHHHHHHHHHHHHcc###### DISOP:02AL 1-3, 28-47| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEcccEEEEcccccEEEEEccHHHHHHHHcccEEEEEEccccccccHHHHHHHHHHHHHHcccccccccccccccHHHHHHccccEEEEEcccccHHHHHHHHHHccEEEEcccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccEEEEEcccccHHHHHHHHccccccHHHHHccccccccccccHHHHHHHcccEEEEEEcccHHHHHHHHHccHHHcccHHHcccEEEEccccEEcccccccHHHHHHHHHHHHHHHHHHHHHHHc //