[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55537.1
DDBJ      :             similar to Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  670/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.4.6
:206 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   117->206 1qqiA PDBj 3e-12 38.9 %
:RPS:PDB   117->206 2d1vA PDBj 7e-19 38.9 %
:RPS:SCOP  117->205 1oddA  a.4.6.1 * 9e-21 27.0 %
:HMM:SCOP  103->206 1ys7A1 a.4.6.1 * 6.7e-24 35.6 %
:RPS:PFM   130->201 PF00486 * Trans_reg_C 8e-12 48.6 %
:HMM:PFM   130->202 PF00486 * Trans_reg_C 3.5e-25 46.6 73/77  
:BLT:SWISS 28->86 NUOD_RALME 6e-04 36.8 %
:BLT:SWISS 103->201 GLNR_STRCO 2e-16 44.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55537.1 GT:GENE AAZ55537.1 GT:PRODUCT similar to Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(1733747..1734367) GB:FROM 1733747 GB:TO 1734367 GB:DIRECTION - GB:PRODUCT similar to Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain GB:PROTEIN_ID AAZ55537.1 GB:DB_XREF GI:71915635 InterPro:IPR001867 LENGTH 206 SQ:AASEQ MPPGEAGPPPGAPGLLRAESRGARAQPPLAAEVTKIKPTKQVDLIELLAHHGAMLTSDIHRPVRDADAALPHRDEERLLGVIPLTDRRKVMVVVGHVVEAANGTDSTATGPLNDDALVIDRDSWQVWAYGKPVSLSYQEFRLLAHLASAPGRVFTRQELLDQVWDPEAHTTARSVDVHVHRIRRKLGALGERLVTVRRVGYVYRPR GT:EXON 1|1-206:0| BL:SWS:NREP 2 BL:SWS:REP 28->86|NUOD_RALME|6e-04|36.8|57/417| BL:SWS:REP 103->201|GLNR_STRCO|2e-16|44.9|98/267| SEG 2->14|ppgeagpppgapg| SEG 90->98|vmvvvghvv| BL:PDB:NREP 1 BL:PDB:REP 117->206|1qqiA|3e-12|38.9|90/104| RP:PDB:NREP 1 RP:PDB:REP 117->206|2d1vA|7e-19|38.9|90/103| RP:PFM:NREP 1 RP:PFM:REP 130->201|PF00486|8e-12|48.6|72/77|Trans_reg_C| HM:PFM:NREP 1 HM:PFM:REP 130->202|PF00486|3.5e-25|46.6|73/77|Trans_reg_C| GO:PFM:NREP 4 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00486|IPR001867| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00486|IPR001867| GO:PFM GO:0003677|"GO:DNA binding"|PF00486|IPR001867| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00486|IPR001867| RP:SCP:NREP 1 RP:SCP:REP 117->205|1oddA|9e-21|27.0|89/100|a.4.6.1| HM:SCP:REP 103->206|1ys7A1|6.7e-24|35.6|104/0|a.4.6.1|1/1|C-terminal effector domain of the bipartite response regulators| OP:NHOMO 1621 OP:NHOMOORG 672 OP:PATTERN -------------------------------------------------------------------- 1362612233323166666-6611766666655556445566645425323223342211BA71B4889C62222333-1335111211111-------1-111111-21--------------1-1-11112-1153344--21231313323333231121411243412222222222224414411-52255555655456565633223255632341552222225A22222221222222222211221222331222211--112211---222-1211--------------------------1-1111111-16448444444433221553111543-144522B944511112112-1--3213112---1-223222233332422222222222-33333332141-233211111111121121111121121222222222--11221------------------------------22422-11111123222111-22211111-13121223-1--242443632252221111111-----------1212-11111121111-42211221121213412-------------------------112311211221-111111--13312211111---1121------32122323333332333-333333333333333333233311112323333332332323333333333--222222221222---1---------21433--------------111111111112-11212323111111123---------1222222222111123321311111------2-111111------------------------------------2322222222131 --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 108 STR:RPRED 52.4 SQ:SECSTR ##################################################################################################EEEcHHHHHHHGGGccGGEEEETTTTEEEETTEEccccHHHHHHHHHHHHTTTccccHHHHHHHHHcTTccccTHHHHHHHHHHHHHHcTccccEEEETTTEEEEccc DISOP:02AL 1-6, 100-111| PSIPRED ccccccccccccHHHHHHHHHHHcccccHHHHHHHHHccccccEEEEEEccccEEEEHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccccccccEEEccEEEEcccEEEEEccEEEEccHHHHHHHHHHHHcccccccHHHHHHHHccccccccccEEHHHHHHHHHHHcccccEEEEEEccEEEEEcc //