[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55542.1
DDBJ      :             similar to DNA-directed RNA polymerase specialized sigma subunit sigma24 -like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  137/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.177.1a.4.13
:196 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   53->181 1or7A PDBj 3e-07 36.3 %
:RPS:PDB   27->189 3dxjF PDBj 7e-19 11.8 %
:RPS:SCOP  18->94 1iw7F3  a.177.1.1 * 3e-11 17.3 %
:RPS:SCOP  136->187 1ku3A  a.4.13.2 * 2e-09 25.0 %
:HMM:SCOP  21->99 1h3lA_ a.177.1.1 * 6.9e-16 38.7 %
:HMM:SCOP  125->192 1or7A1 a.4.13.2 * 2.8e-14 39.7 %
:RPS:PFM   32->93 PF04542 * Sigma70_r2 6e-04 36.7 %
:RPS:PFM   135->186 PF08281 * Sigma70_r4_2 4e-09 48.1 %
:HMM:PFM   135->186 PF08281 * Sigma70_r4_2 1.9e-18 48.1 52/54  
:HMM:PFM   32->103 PF04542 * Sigma70_r2 8.1e-17 38.6 70/71  
:BLT:SWISS 29->191 SIGW_BACSU 2e-10 29.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55542.1 GT:GENE AAZ55542.1 GT:PRODUCT similar to DNA-directed RNA polymerase specialized sigma subunit sigma24 -like protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1738634..1739224 GB:FROM 1738634 GB:TO 1739224 GB:DIRECTION + GB:PRODUCT similar to DNA-directed RNA polymerase specialized sigma subunit sigma24 -like protein GB:PROTEIN_ID AAZ55542.1 GB:DB_XREF GI:71915640 LENGTH 196 SQ:AASEQ MRVQPFRRARGYQSVSTIAETADDADRWFIELYDQHRSAVFSAALRLCARWADAEDLAAETFVRAYRAAGSYGPERRSQMRPRAWLMTILWNVWRNRARTAARKPPPAPLTDDVDLADPRQDVAEIAEHHETSGALATLLNQLSTMQREAIVLRYVADLSLSEVAAVLGIPEGTAKSHIFRGLAKLRALTRGGSYA GT:EXON 1|1-196:0| BL:SWS:NREP 1 BL:SWS:REP 29->191|SIGW_BACSU|2e-10|29.7|155/187| SEG 95->109|rnrartaarkpppap| BL:PDB:NREP 1 BL:PDB:REP 53->181|1or7A|3e-07|36.3|113/181| RP:PDB:NREP 1 RP:PDB:REP 27->189|3dxjF|7e-19|11.8|161/349| RP:PFM:NREP 2 RP:PFM:REP 32->93|PF04542|6e-04|36.7|60/70|Sigma70_r2| RP:PFM:REP 135->186|PF08281|4e-09|48.1|52/54|Sigma70_r4_2| HM:PFM:NREP 2 HM:PFM:REP 135->186|PF08281|1.9e-18|48.1|52/54|Sigma70_r4_2| HM:PFM:REP 32->103|PF04542|8.1e-17|38.6|70/71|Sigma70_r2| GO:PFM:NREP 10 GO:PFM GO:0003677|"GO:DNA binding"|PF04542|IPR007627| GO:PFM GO:0003700|"GO:transcription factor activity"|PF04542|IPR007627| GO:PFM GO:0006352|"GO:transcription initiation"|PF04542|IPR007627| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF04542|IPR007627| GO:PFM GO:0016987|"GO:sigma factor activity"|PF04542|IPR007627| GO:PFM GO:0003677|"GO:DNA binding"|PF08281|IPR013249| GO:PFM GO:0003700|"GO:transcription factor activity"|PF08281|IPR013249| GO:PFM GO:0006352|"GO:transcription initiation"|PF08281|IPR013249| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF08281|IPR013249| GO:PFM GO:0016987|"GO:sigma factor activity"|PF08281|IPR013249| RP:SCP:NREP 2 RP:SCP:REP 18->94|1iw7F3|3e-11|17.3|75/184|a.177.1.1| RP:SCP:REP 136->187|1ku3A|2e-09|25.0|52/61|a.4.13.2| HM:SCP:REP 21->99|1h3lA_|6.9e-16|38.7|75/75|a.177.1.1|1/1|Sigma2 domain of RNA polymerase sigma factors| HM:SCP:REP 125->192|1or7A1|2.8e-14|39.7|68/68|a.4.13.2|1/1|Sigma3 and sigma4 domains of RNA polymerase sigma factors| OP:NHOMO 201 OP:NHOMOORG 137 OP:PATTERN -------------------------------------------------------------------- 235-111122211--1111-121113111111221222121-111--12---1-------1-3-5242332-----------3-------11------------1------------------------------1-1122--11-----------------------1--------------111------1-----------------1112-----11-1-1---------------------------------------------------------------------------------------------------------------------------------12--1--11--1-------3------------1223-1-2-121---------------------1--------------11-12--------------------------------------------------------1-1--------------------2------11-12221--11-----11------1-----------------1-111----------------1---1-2222-2-2------------------------------1-1-----------------------------1--------------------------------------------------------------------------------------------------------------------------------------1-------1---------------------------------11--1---------------111-----------------------------------------------14- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 173 STR:RPRED 88.3 SQ:SECSTR ##################HHHHHHHHHHHHHHHHHTHHHHHHHHGGGccccccHHHHHHHHHHHHHHHHHcccTTccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcTTccHHHHHHHHHHTcccccTTcccTTcccccGGGTccccccccHHHHcc##### DISOP:02AL 1-18, 192-196| PSIPRED cccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccc //