[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55560.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:111 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   79->110 PF08006 * DUF1700 0.00022 34.4 32/181  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55560.1 GT:GENE AAZ55560.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(1755848..1756183) GB:FROM 1755848 GB:TO 1756183 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ55560.1 GB:DB_XREF GI:71915658 LENGTH 111 SQ:AASEQ MRYRYSEAERAAFDIVRAIRVGDADADMAEALGADRLAARAPSDEVIRLRYDRAADHGHEGLLMLTTALARLALASLTALAQAQHRNLDDLLDDYETHLNTGRSFGNNEER GT:EXON 1|1-111:0| SEG 62->83|llmlttalarlalasltalaqa| HM:PFM:NREP 1 HM:PFM:REP 79->110|PF08006|0.00022|34.4|32/181|DUF1700| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 102-111| PSIPRED ccccccHHHHHHHHHHHHHHcccccHHHHHHHcHHHHHHccccccEEHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccc //