[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55572.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:290 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   171->281 PF04582 * Reo_sigmaC 9.1e-06 22.2 108/326  
:HMM:PFM   52->109 PF03706 * UPF0104 0.0002 24.6 57/294  
:BLT:SWISS 141->242 MYH4_CANFA 6e-05 32.6 %
:TM
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55572.1 GT:GENE AAZ55572.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1773073..1773945 GB:FROM 1773073 GB:TO 1773945 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ55572.1 GB:DB_XREF GI:71915670 LENGTH 290 SQ:AASEQ MSRPHPVIDPDLPEKARTQLETALHPPQDTPPAEHRRTLLPQPIADHPVATVVIILLVLLVGMRLLARVFVFVAAAVLLIGAGILLIALLAPRRDPQRAARQLRDRYRDHYVTADDLDEEAAALLARAQRAVATITSAHVVRDDILDVALNTAVLPRQLWETARALRSLTELRSRPTPSHGDDTTIAMLLDDRKRALQAIHQSVADRVAALEDYATRVSEAEQAWQRVATLRRLIAEQEELRDLLAATAADEVAVRELAELTERARAAEAHLQNAAHQAAQAALRLPGVD GT:EXON 1|1-290:0| BL:SWS:NREP 1 BL:SWS:REP 141->242|MYH4_CANFA|6e-05|32.6|95/1939| COIL:NAA 35 COIL:NSEG 1 COIL:REGION 252->286| TM:NTM 2 TM:REGION 45->67| TM:REGION 71->92| SEG 49->106|vatvviillvllvgmrllarvfvfvaaavlligagilliallaprrdpqraarqlrdr| SEG 112->134|vtaddldeeaaallaraqravat| SEG 254->286|avrelaelteraraaeahlqnaahqaaqaalrl| HM:PFM:NREP 2 HM:PFM:REP 171->281|PF04582|9.1e-06|22.2|108/326|Reo_sigmaC| HM:PFM:REP 52->109|PF03706|0.0002|24.6|57/294|UPF0104| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 27-29, 97-101, 169-184| PSIPRED cccccccccccccHHHHHHHHHHcccccccccHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //