[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55581.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:324 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55581.1 GT:GENE AAZ55581.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(1781265..1782239) GB:FROM 1781265 GB:TO 1782239 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ55581.1 GB:DB_XREF GI:71915679 LENGTH 324 SQ:AASEQ MDLTSKARALGLASEAAATLSSLADFPDPPPAPLPGREAADELLDAAAVEGADRADLRALWPDQDWPAAARWLVDACYARILADVGRPGWVDWPDVISADDPRVRCAPIYAFLAAVDVLRERHRSRGVPEDVTAATLADLGRHVAKTRRMYGRVGLDLPVWIALHYRGSLYEVGRLQYETAYLDSGDFPELVGVVDERLVARLHIPAGEPLSADAVDASLARAGEVLSAVTGERVRVAVCTSWLLDPQLRDYLPPESNIRAFQDRFVLSDHEGPGDADMFRFVFECPEVAPDRVTPVTRLQHAVLDLLKRGGSWRVRTGWLRLP GT:EXON 1|1-324:0| SEG 7->35|aralglaseaaatlssladfpdpppaplp| SEG 38->48|eaadelldaaa| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------111-----1----1---------1--1-----------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccHHHHHHHHccHHHHHHHHHHHHHccccccccccccccHHHHHHHHccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcEEcccccccHHHHHHHHHHHHEEEEEEEEEEEEEcccccccHHHcccccccEEEEEccccccccHHHHHHHHHHHHHHHHHccccEEEEEEEcEEEccHHHHHHccccccEEEEEEccEEEccccccccccccEEEccccccccccccccHHHHHHHHHHHccccEEEEEEEEEcc //