[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55585.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.80.8
:147 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   59->126 2bm7C PDBj 1e-04 36.8 %
:RPS:PDB   27->129 2bm7C PDBj 3e-08 24.0 %
:RPS:SCOP  56->129 2j8iA1  b.80.8.1 * 5e-08 30.0 %
:HMM:PFM   61->79 PF00805 * Pentapeptide 0.00077 42.1 19/40  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55585.1 GT:GENE AAZ55585.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1785219..1785662 GB:FROM 1785219 GB:TO 1785662 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ55585.1 GB:DB_XREF GI:71915683 LENGTH 147 SQ:AASEQ MYRCVVRLPVPEDASKEEHVEHQQRTLRFASFREVRHTIIRIIGRRLRKDAPVSWQGCDFDFTGVVFDGGDLSDAHVTGGRISFREAQFTNSRMDFTGATFSGGTVDFADVRDLSVMPQGLREATVKAAPEAKVLLPEEWLSSSPAD GT:EXON 1|1-147:0| BL:PDB:NREP 1 BL:PDB:REP 59->126|2bm7C|1e-04|36.8|68/180| RP:PDB:NREP 1 RP:PDB:REP 27->129|2bm7C|3e-08|24.0|100/180| HM:PFM:NREP 1 HM:PFM:REP 61->79|PF00805|0.00077|42.1|19/40|Pentapeptide| RP:SCP:NREP 1 RP:SCP:REP 56->129|2j8iA1|5e-08|30.0|70/98|b.80.8.1| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ----1----------------------------------------------------------------21---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 104 STR:RPRED 70.7 SQ:SECSTR ######################ccEEEEccccTTEEEEEEEccccEEEc###cccccEEEEcTTcccTTcccTTcccTTcccTcTTcccTTTTcccTTcccTTcccTTcccTTccccHHHHHHcccTTc################## DISOP:02AL 13-21, 143-147| PSIPRED ccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEEcccccccEEcccEEEEEEccccccEEEEccccccccEEEHHHcccHHHccHHHHHHHHccccccEEEccHHHccccccc //