[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55590.1
DDBJ      :             Low molecular weight phosphotyrosine protein phosphatase
Swiss-Prot:             

Homologs  Archaea  27/68 : Bacteria  319/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
c.44.1
:138 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->123 1ljlA PDBj 5e-15 38.1 %
:RPS:PDB   7->124 2cd7A PDBj 2e-29 34.2 %
:RPS:SCOP  5->124 1jf8A  c.44.1.1 * 9e-30 32.8 %
:HMM:SCOP  5->132 1jf8A_ c.44.1.1 * 2e-37 44.1 %
:RPS:PFM   8->122 PF01451 * LMWPc 9e-14 40.0 %
:HMM:PFM   8->132 PF01451 * LMWPc 2.7e-33 35.2 125/140  
:BLT:SWISS 9->124 ARSC1_STAEQ 1e-16 41.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55590.1 GT:GENE AAZ55590.1 GT:PRODUCT Low molecular weight phosphotyrosine protein phosphatase GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(1792244..1792660) GB:FROM 1792244 GB:TO 1792660 GB:DIRECTION - GB:PRODUCT Low molecular weight phosphotyrosine protein phosphatase GB:PROTEIN_ID AAZ55590.1 GB:DB_XREF GI:71915688 InterPro:IPR000106 LENGTH 138 SQ:AASEQ MSNVEIPQVLFVCVHNAGRSQMAAAFLQHLGAGKVRVRSAGSAPADAVNPAVVQAMAEVGIDISANVPKVLTAEEVRSSDVVITMGCGDACPIYPGKRYLNWDLPDPAGKDVEAVRPIRDRIRALVEELLEELTSSSQ GT:EXON 1|1-138:0| BL:SWS:NREP 1 BL:SWS:REP 9->124|ARSC1_STAEQ|1e-16|41.2|114/132| SEG 125->133|lveelleel| BL:PDB:NREP 1 BL:PDB:REP 9->123|1ljlA|5e-15|38.1|113/130| RP:PDB:NREP 1 RP:PDB:REP 7->124|2cd7A|2e-29|34.2|117/131| RP:PFM:NREP 1 RP:PFM:REP 8->122|PF01451|9e-14|40.0|115/141|LMWPc| HM:PFM:NREP 1 HM:PFM:REP 8->132|PF01451|2.7e-33|35.2|125/140|LMWPc| GO:PFM:NREP 2 GO:PFM GO:0004725|"GO:protein tyrosine phosphatase activity"|PF01451|IPR017867| GO:PFM GO:0006470|"GO:protein amino acid dephosphorylation"|PF01451|IPR017867| RP:SCP:NREP 1 RP:SCP:REP 5->124|1jf8A|9e-30|32.8|119/130|c.44.1.1| HM:SCP:REP 5->132|1jf8A_|2e-37|44.1|127/0|c.44.1.1|1/1|Phosphotyrosine protein phosphatases I| OP:NHOMO 477 OP:NHOMOORG 355 OP:PATTERN ------------------------11112131--1--112111211111-1-1--1--1-1------1 112-3--433211132-11-13--1111111-3131541412211212211-512-2----22-1-11211-----1-----111111--11-1-----------1-311---------------2112212222211122111111111111----------11-1111-------------1411111-21-111111211112-111111-1111121----------111-1-1-1111---1111222--121122--1-1--11-1-21-111--------------------------------------------1121111112--1111-22-1111-11--2---21----11--1111------1--1-----1-111--311111----------------22--2---------1---1-11--11--1--1----------------111-------------------------------1-1------1--1111111-662-1-----11-1-21-143--2-21211---4-----1----------2-112-233-212-2111--1-1111-1111111111------1-1------------1----------11-1--------1-1----1--1------121------------------------------------------------------------------------1-------------------1---------111--------------------1------1-1111--1--1--11----------------------------1--------------1-----------------1---------------------------1-------11- ------------12------21-----------1-----------------------------------------------------------------------------------------------------------------------------------------------1------1---1---------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 124 STR:RPRED 89.9 SQ:SECSTR ccccccEEEEEEETTcccHHHHHHHHHHHHcTTTEEEEEEEccccccccHHHHHHHHHTTcccTTcccccccHHHHHHccEEEEccHHHTcccccTccEEEccccccTTccHHHHHHHHHHHHH############## DISOP:02AL 1-4, 135-138| PSIPRED cccccccEEEEEEEccccccHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHccccccccccccccHHHHHcccEEEEEcccccccccccccEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccc //