Thermobifida fusca YX (tfus0)
Gene : AAZ55599.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:231 amino acids
:HMM:PFM   30->49 PF09976 * DUF2133 6.6e-05 20.0 20/43  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55599.1 GT:GENE AAZ55599.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1800128..1800823 GB:FROM 1800128 GB:TO 1800823 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ55599.1 GB:DB_XREF GI:71915697 LENGTH 231 SQ:AASEQ MPSVGRTGSPNHTRGKFSMRLIPSTPAGCLAAAVGVVVVGGLGYVGYQYFSDDEFTLPVTALTSPAPTPSPVDATFTLPGTCAEAHAPELVGDLAPPGATLVENVETIDEADARQLSCTWSTDSQSLTLVFAVNVDPSDRVSVVSLNDAEQQTREMGWEVDVDVTTDSYQNTHTDELGGELKTLTTVDGSLQQLSLQLPGDVHVSLIASSMDISQEDMERILITAAQQLQN GT:EXON 1|1-231:0| TM:NTM 1 TM:REGION 27->49| SEG 27->47|agclaaavgvvvvgglgyvgy| SEG 56->72|tlpvtaltspaptpspv| SEG 190->198|slqqlslql| HM:PFM:NREP 1 HM:PFM:REP 30->49|PF09976|6.6e-05|20.0|20/43|DUF2133| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10, 230-231| PSIPRED cccccccccccccccEEEEEEcccccHHHHHHHHHHHHcccccHHcEEEEccccEEEEEEEEcccccccccccEEEEccccccHHccHHHHHHcccccHHHHHHHHHHccccccEEEEEEcccccEEEEEEEEEccccccEEEEEEccHHHHHHHcccEEEEEEEcccccccccHHHcccEEEEEEcccccEEEEEEccccEEEEEEEEcccccHHHHHHHHHHHHHHHcc //