[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55604.1
DDBJ      :             transcriptional regulator, ArsR family
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  114/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:143 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   35->107 2jscB PDBj 5e-12 46.6 %
:RPS:PDB   45->109 1bibA PDBj 2e-14 24.6 %
:RPS:SCOP  19->103 1fnnA1  a.4.5.11 * 2e-15 11.8 %
:HMM:SCOP  16->114 1u2wA1 a.4.5.5 * 4.8e-22 40.4 %
:RPS:PFM   45->89 PF01022 * HTH_5 3e-09 57.8 %
:HMM:PFM   45->90 PF01022 * HTH_5 1.2e-16 54.3 46/47  
:BLT:SWISS 35->107 CMTR_MYCTU 2e-11 46.6 %
:PROS 55->69|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55604.1 GT:GENE AAZ55604.1 GT:PRODUCT transcriptional regulator, ArsR family GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(1806101..1806532) GB:FROM 1806101 GB:TO 1806532 GB:DIRECTION - GB:PRODUCT transcriptional regulator, ArsR family GB:PROTEIN_ID AAZ55604.1 GB:DB_XREF GI:71915702 InterPro:IPR001845 InterPro:IPR003439 LENGTH 143 SQ:AASEQ MFSLFLVIRFRRYYRLMAMVNGRSGDSPADSDLRAAQALFHSLSDVTRLAIVRRLAQGEARVADLVAQLGLAQSTVSKHVACLRDCGLVKGRPEGRQVFYSLAHRELFDLLAAAEVVLAATGNAVALCPNYGGEDAVAEACGE GT:EXON 1|1-143:0| BL:SWS:NREP 1 BL:SWS:REP 35->107|CMTR_MYCTU|2e-11|46.6|73/118| PROS 55->69|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 110->120|llaaaevvlaa| BL:PDB:NREP 1 BL:PDB:REP 35->107|2jscB|5e-12|46.6|73/97| RP:PDB:NREP 1 RP:PDB:REP 45->109|1bibA|2e-14|24.6|65/294| RP:PFM:NREP 1 RP:PFM:REP 45->89|PF01022|3e-09|57.8|45/47|HTH_5| HM:PFM:NREP 1 HM:PFM:REP 45->90|PF01022|1.2e-16|54.3|46/47|HTH_5| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01022|IPR001845| GO:PFM GO:0005622|"GO:intracellular"|PF01022|IPR001845| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01022|IPR001845| RP:SCP:NREP 1 RP:SCP:REP 19->103|1fnnA1|2e-15|11.8|85/103|a.4.5.11| HM:SCP:REP 16->114|1u2wA1|4.8e-22|40.4|99/0|a.4.5.5|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 169 OP:NHOMOORG 123 OP:PATTERN --------11111111---------------------------------------------------1 --1--1-3113---2--11-16--2111111-6-3131-1--1-5214---14-521---1211-1--112-----------3------------------------------------------------------11-----12-----------1----1--1---1--1-----1--------------1111111111111111------112-----------------------------------1---11---------1111-----------------------------------------------------1-------------------------------1--------1-1----3--1--------1-1--1--111------------------1---11------11--1111-----1-----------------------------------------------------------------21111------11--------11-----------------------------------------------------1--------1--1------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 83 STR:RPRED 58.0 SQ:SECSTR ##########################cccETEEEccHHHHHHcccHHHHHHHHHHTTccccHHHHHHHHTccHHHHHHHHHHHHHTTcccEEETTTEEEcccccccccH################################## DISOP:02AL 20-32, 142-143| PSIPRED cHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccEEEEEEcHHHHHHHHHHHHHHHHcccccccccccccccHHHHccccc //