[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55609.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  29/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:124 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->113 3dcaA PDBj 4e-12 34.3 %
:RPS:PDB   3->120 3dcaA PDBj 4e-16 32.2 %
:RPS:SCOP  35->107 2fiuA1  d.58.4.16 * 2e-08 27.1 %
:HMM:SCOP  21->114 2fiuA1 d.58.4.16 * 2.3e-15 25.3 %
:HMM:PFM   36->100 PF07045 * DUF1330 5.1e-14 32.3 62/65  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55609.1 GT:GENE AAZ55609.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(1811615..1811989) GB:FROM 1811615 GB:TO 1811989 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ55609.1 GB:DB_XREF GI:71915707 LENGTH 124 SQ:AASEQ MAVDPTRADLARFLDEDPGGPIVMLNLLRFAPEGRASYAEYTRRARQILHKYGAELVYAGDGATPLVAEEGQAWDAVLLVRYPSREAFIRMVEDPEYQQITEFRTQALSEAVLQPTTPWPTRSA GT:EXON 1|1-124:0| BL:PDB:NREP 1 BL:PDB:REP 3->113|3dcaA|4e-12|34.3|108/127| RP:PDB:NREP 1 RP:PDB:REP 3->120|3dcaA|4e-16|32.2|115/127| HM:PFM:NREP 1 HM:PFM:REP 36->100|PF07045|5.1e-14|32.3|62/65|DUF1330| RP:SCP:NREP 1 RP:SCP:REP 35->107|2fiuA1|2e-08|27.1|70/95|d.58.4.16| HM:SCP:REP 21->114|2fiuA1|2.3e-15|25.3|91/0|d.58.4.16|1/1|Dimeric alpha+beta barrel| OP:NHOMO 36 OP:NHOMOORG 31 OP:PATTERN -------------------------------------------------------------------- ------------------------1------1----1---------------------------------1----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1121-------111---1-121----------------------3---------------11----------1----------------------------------------------1--1---------------------------------------------------1---------------------1--------------------------1----------------------------------1------------------------2-----------------------------------------------------------------------------------------------------------------------------------------------------1----1---------------------------------------------------------------------------------------------------- ------------------------------------1----1------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 117 STR:RPRED 94.4 SQ:SECSTR ##ccccHHHHHHHHHHcccccE#EEEEEEEccccHHHHHHHHHHHHHHHHHHTcEEEEEEcccccccccTTccccEEEEEEEccHHHHHHHHTcHHHHHHHHHHHHHEEEEEEEEEcccc#### DISOP:02AL 1-3, 122-124| PSIPRED ccccHHHHHHHHHHcccccccEEEEEccccccccHHHHHHHHHHHHHHHHHcccEEEEEEccEEEEEccccccccEEEEEEcccHHHHHHHHccHHHHHHHHHHHHHHHccEEEEccccccccc //