[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55631.1
DDBJ      :             CRISPR-associated protein, Cse3 family
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  33/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.53
:207 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   168->205 1wj9A PDBj 2e-06 50.0 %
:HMM:SCOP  1->64 1wj9A1 d.58.53.1 * 3.3e-12 43.5 %
:HMM:SCOP  72->205 1wj9A2 d.58.53.1 * 3.4e-33 40.3 %
:RPS:PFM   21->205 PF08798 * CRISPR_assoc 6e-20 45.6 %
:HMM:PFM   1->205 PF08798 * CRISPR_assoc 7.3e-58 45.4 183/214  
:BLT:SWISS 23->206 YGCH_ECOLI 6e-07 31.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55631.1 GT:GENE AAZ55631.1 GT:PRODUCT CRISPR-associated protein, Cse3 family GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(1839830..1840453) GB:FROM 1839830 GB:TO 1840453 GB:DIRECTION - GB:PRODUCT CRISPR-associated protein, Cse3 family GB:PROTEIN_ID AAZ55631.1 GB:DB_XREF GI:71915729 InterPro:IPR010179 LENGTH 207 SQ:AASEQ MHAAVMSSFPTLLPSDTDGPRVLWRIDRTSRAEVFLYIVSPPKPDLTHLVEQAGWPTQPTWESYDYTPFLSRLAKGDVWAFRLTANPVHSIRRKAGEPTKLTAHLTQRYQKKWLLQRQDAAGFRVVEKPAEKRRLPEGDEHELIVHNRRDWNFSKGARKGRPVSLVTVTFDGRLEVTDPDALRRALISGIGRAKAYGCGLMTLAPVG GT:EXON 1|1-207:0| BL:SWS:NREP 1 BL:SWS:REP 23->206|YGCH_ECOLI|6e-07|31.8|170/100| BL:PDB:NREP 1 BL:PDB:REP 168->205|1wj9A|2e-06|50.0|38/188| RP:PFM:NREP 1 RP:PFM:REP 21->205|PF08798|6e-20|45.6|160/208|CRISPR_assoc| HM:PFM:NREP 1 HM:PFM:REP 1->205|PF08798|7.3e-58|45.4|183/214|CRISPR_assoc| HM:SCP:REP 1->64|1wj9A1|3.3e-12|43.5|62/0|d.58.53.1|1/1|CRISPR-associated protein| HM:SCP:REP 72->205|1wj9A2|3.4e-33|40.3|124/0|d.58.53.1|1/1|CRISPR-associated protein| OP:NHOMO 37 OP:NHOMOORG 35 OP:PATTERN -----------------------------------------------1-1------------------ ---111-----1-1----------------------1----11-----------------1---11-1-12---------------------------------------------------------------------11-------1---1------------------------------1-----------------------------------------------------------------------11-11---------------------------1-------------------------------------------------------------1----------------------------------------------------------------1------------------------------------------------1-----------------------------------------------------------------------------------------------------------------1------------1--------1-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------1------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 38 STR:RPRED 18.4 SQ:SECSTR #######################################################################################################################################################################EEEEEEEEEccHHHHHHHHHHcccccTTTTccccEEEc## DISOP:02AL 91-105, 151-161| PSIPRED cHHHHHHHccccccccccccEEEEEEccccccccEEEEEEcccccEEEEEEcccccccccEEEEEEccccHHHccccEEEEEEEEccEEEEcccccccccccccccHHHHHHHHHHHHHHccEEEEHHHHHHHHHHHHcccEEEEEEcccccccccccccccEEEEEEEEEEEEEEEcHHHHHHHHHHccccccHHccccEEEEccc //