[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55692.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:68 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   12->64 PF04149 * DUF397 2e-10 50.0 %
:HMM:PFM   11->64 PF04149 * DUF397 5.8e-25 51.9 54/56  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55692.1 GT:GENE AAZ55692.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1927154..1927360 GB:FROM 1927154 GB:TO 1927360 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ55692.1 GB:DB_XREF GI:71915790 LENGTH 68 SQ:AASEQ MNSDYTDLSKLRWHKSSYSSGNGGNCIEVAETPTTILVRDTQHRNLGYLVFPLTEWTLFLRNLKNGFC GT:EXON 1|1-68:0| RP:PFM:NREP 1 RP:PFM:REP 12->64|PF04149|2e-10|50.0|52/55|DUF397| HM:PFM:NREP 1 HM:PFM:REP 11->64|PF04149|5.8e-25|51.9|54/56|DUF397| OP:NHOMO 7 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------1----1---5---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 15-22| PSIPRED ccccccccccccEEcccccccccccEEEEEEcccEEEEEccccccccEEEEcHHHHHHHHHHHHHccc //