[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55702.1
DDBJ      :             regulatory protein, MerR
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  464/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.6.1
:136 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->76 1q06B PDBj 2e-13 40.8 %
:RPS:PDB   3->99 3d70A PDBj 2e-21 25.0 %
:RPS:SCOP  6->81 1q05A  a.6.1.3 * 9e-18 38.2 %
:HMM:SCOP  5->119 1jbgA_ a.6.1.3 * 9.9e-25 45.6 %
:RPS:PFM   8->44 PF00376 * MerR 2e-05 58.3 %
:HMM:PFM   8->44 PF00376 * MerR 6.7e-15 59.5 37/38  
:HMM:PFM   49->113 PF09278 * MerR-DNA-bind 1.4e-08 35.5 62/65  
:BLT:SWISS 5->77 MERR_BACCE 1e-14 43.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55702.1 GT:GENE AAZ55702.1 GT:PRODUCT regulatory protein, MerR GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1940105..1940515 GB:FROM 1940105 GB:TO 1940515 GB:DIRECTION + GB:PRODUCT regulatory protein, MerR GB:PROTEIN_ID AAZ55702.1 GB:DB_XREF GI:71915800 InterPro:IPR000551 LENGTH 136 SQ:AASEQ MGRDRMQIGEVAERTGLSLRTIRYYGEVGLVVPSARSKGGFRLYTESDVARLLLIKQMKPLGFSLEQTRDLLGVLDRLDSPGLDDAERAALTDQLDRFETAVAARCAALREQLALAEEFGARLRARRGAAVPRARA GT:EXON 1|1-136:0| BL:SWS:NREP 1 BL:SWS:REP 5->77|MERR_BACCE|1e-14|43.8|73/132| SEG 103->135|aarcaalreqlalaeefgarlrarrgaavprar| BL:PDB:NREP 1 BL:PDB:REP 6->76|1q06B|2e-13|40.8|71/126| RP:PDB:NREP 1 RP:PDB:REP 3->99|3d70A|2e-21|25.0|96/276| RP:PFM:NREP 1 RP:PFM:REP 8->44|PF00376|2e-05|58.3|36/37|MerR| HM:PFM:NREP 2 HM:PFM:REP 8->44|PF00376|6.7e-15|59.5|37/38|MerR| HM:PFM:REP 49->113|PF09278|1.4e-08|35.5|62/65|MerR-DNA-bind| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00376|IPR000551| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00376|IPR000551| RP:SCP:NREP 1 RP:SCP:REP 6->81|1q05A|9e-18|38.2|76/122|a.6.1.3| HM:SCP:REP 5->119|1jbgA_|9.9e-25|45.6|103/106|a.6.1.3|1/1|Putative DNA-binding domain| OP:NHOMO 931 OP:NHOMOORG 465 OP:PATTERN -------------------------------------------------------------------- 11-11-122232-2-------1--12-----122223413-5441-11111--24-1---543-7233441----1----21------------------------------------------------------1-1--1--1-211222111-1-----11111121--------------11-1----22222222663343462-14323323112----22222153----------------1----11-----2-1---------------2--111-1--1--11-----11111-1111111111111-1111--2111111111111--22----11---2----221------1-------2--2--2----------2141-2--22222222224-22214352533-233322432233142245-33232222111111114----13-------------------------------22-8111112344544221--662-3332125721113-1431-31532-1-11213--------------1--111--------1---------1-2-1111112---------------------------11111-12-1--12222231242241122322---2--2------23112212212222222-222222222222222222233311124323233333332322332221112--222222222222---1------11--2-12---1-1-21121-1-224341--1-2322242222222224422----------121211111221-132--1-------------11----------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 97 STR:RPRED 71.3 SQ:SECSTR ##cccEEHHHHHHHHTccHHHHHHHHHTTcccccEcTTTccEEEcGGGGGHHHHHHHHHHHTccHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHH##################################### DISOP:02AL 1-3, 127-129, 131-136| PSIPRED cccccccHHHHHHHHcccHHHHHHHHHHcccccccccccccEEccHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //