[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55738.1
DDBJ      :             putative transport system permease ABC transporter protein
Swiss-Prot:             

Homologs  Archaea  37/68 : Bacteria  578/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:292 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   85->292 2r6gG PDBj 2e-21 31.4 %
:RPS:PDB   17->182 3b8eA PDBj 5e-04 10.3 %
:RPS:PDB   181->218 3dhwA PDBj 1e-09 36.8 %
:RPS:SCOP  22->292 2r6gG1  f.58.1.1 * 7e-32 28.5 %
:RPS:PFM   157->226 PF00528 * BPD_transp_1 5e-05 34.3 %
:HMM:PFM   99->269 PF00528 * BPD_transp_1 6.9e-25 25.3 166/185  
:HMM:PFM   15->47 PF10348 * DUF2427 0.00016 27.3 33/105  
:BLT:SWISS 24->292 YESQ_BACSU 3e-75 48.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55738.1 GT:GENE AAZ55738.1 GT:PRODUCT putative transport system permease ABC transporter protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(1981803..1982681) GB:FROM 1981803 GB:TO 1982681 GB:DIRECTION - GB:PRODUCT putative transport system permease ABC transporter protein GB:PROTEIN_ID AAZ55738.1 GB:DB_XREF GI:71915836 LENGTH 292 SQ:AASEQ MVTKTTATATGQKKARNERIRRLLLIHAGLVAFGVVMLYPLLWMLSSSFKPTEEIFRDPSLIPSTFMPGNYTEGWTALQHPFHHYLLNSAIVVAGAIIGNLLGCSMAAYAFARLEFFGKKLFFAIMLMTIMLPIHVVIVPQYILFAKLDWINTFYPLIVPKLLATDGFFVFLMVQFIRGLPRDLDEAARIDGCGHVRIFLQVILPLSMPALATTAIFTFIWTWNDFFSQLIFLTDPNMYTVPVALRTFVDSTSQTSWGPLFAMSIVALGPVFGFFLAGQRYLVRGIATTGIK GT:EXON 1|1-292:0| BL:SWS:NREP 1 BL:SWS:REP 24->292|YESQ_BACSU|3e-75|48.9|268/296| TM:NTM 6 TM:REGION 23->45| TM:REGION 89->111| TM:REGION 123->145| TM:REGION 157->179| TM:REGION 198->220| TM:REGION 262->284| SEG 3->15|tkttatatgqkka| BL:PDB:NREP 1 BL:PDB:REP 85->292|2r6gG|2e-21|31.4|207/284| RP:PDB:NREP 2 RP:PDB:REP 17->182|3b8eA|5e-04|10.3|156/998| RP:PDB:REP 181->218|3dhwA|1e-09|36.8|38/203| RP:PFM:NREP 1 RP:PFM:REP 157->226|PF00528|5e-05|34.3|70/195|BPD_transp_1| HM:PFM:NREP 2 HM:PFM:REP 99->269|PF00528|6.9e-25|25.3|166/185|BPD_transp_1| HM:PFM:REP 15->47|PF10348|0.00016|27.3|33/105|DUF2427| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 22->292|2r6gG1|7e-32|28.5|267/284|f.58.1.1| OP:NHOMO 3444 OP:NHOMOORG 620 OP:PATTERN 221-41-145454542713331-171161-3-----------------------3352111532---- ---1m213334-1123344-423349444443255514575437O*c2DIH5RKO12B--978BL4ESaI68666GDA1---5-------------------------1---------------------------9BB78---76221311-11222222212221333--1-----1----EE276EF-953222222331132223SIAA4822354B2945778777A*111111111111111-1---5411231-22233--22---1-42552325344422666777766664333344443333355---5553G4-3B1111121514D2--1445f-26233F--231--1J--1886J2-1-------111112-FBA1-1535534477477677I---6--4-19Q--ZWWMbYRpnhXQ52---9HA8769G85--------4112--13-----------------------------3---2-144436998865344455BC5554347562323--2237-23342668E----1--3--------------1-3--111--11111---------222224-1--------1------------------125-----1-6----------------------1---------26981413333333333-33333334333323333325656611223232222222222326-1133321-499999999999---------11111-86D111222-----1--1----------1-22223365633344656----------1222333333154411111111111111-------------------1811111-11-11111111---31---7LFB89T9DA-2- -------------2------------------------------------------------------------------------------------------------------------------------------------------------2-----------1--------------1--------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 275 STR:RPRED 94.2 SQ:SECSTR ################cHHHHHTTTccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccTHHHHTTTTTcccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcTTGGGcccccccTTTTTTTTHHHTTTTHHHHHHHHHHHHHHcTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHTccHHHHHHcccGGGccHHHHGGGGccccccc#HHHHHHHHHHTHHHHHHHHHHHTTTccccccTTTcc DISOP:02AL 1-5, 7-23| PSIPRED cccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //