[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55742.1
DDBJ      :             putative oxidoreductase
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  30/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.2.1d.81.1
:384 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   53->122 3f4lA PDBj 7e-08 34.3 %
:RPS:PDB   6->290 3dtyB PDBj 5e-19 16.5 %
:RPS:SCOP  7->142 1ydwA1  c.2.1.3 * 2e-12 19.5 %
:HMM:SCOP  6->188 1tltA1 c.2.1.3 * 3.9e-29 33.3 %
:HMM:SCOP  132->325 2nvwA2 d.81.1.5 * 2e-10 21.2 %
:RPS:PFM   18->127 PF01408 * GFO_IDH_MocA 4e-10 40.6 %
:HMM:PFM   9->128 PF01408 * GFO_IDH_MocA 9.8e-16 35.0 117/120  
:HMM:PFM   140->201 PF02894 * GFO_IDH_MocA_C 0.00091 21.4 56/115  
:BLT:SWISS 53->122 YHHX_ECOLI 2e-07 34.3 %
:BLT:SWISS 247->364 LEXA_LACRJ 8e-04 28.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55742.1 GT:GENE AAZ55742.1 GT:PRODUCT putative oxidoreductase GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1987333..1988487 GB:FROM 1987333 GB:TO 1988487 GB:DIRECTION + GB:PRODUCT putative oxidoreductase GB:PROTEIN_ID AAZ55742.1 GB:DB_XREF GI:71915840 LENGTH 384 SQ:AASEQ MTPTLPIPVVLAGVHGHGRSHLRTLQRLSEQGIVRLVGVCDPRPVPPSLLDGFGSVTYSPDLSDVLRTTGAAITILVTPIHTHLPLARTALEHGSHLLVEKPPTATLAEFEELCTAVALSGLACQVGFQSLGSSAVAAVRSLIADGAIGAVRGIGGAGTWIRTSAYYERAAWAGRRRLDGRDVVDGALTNPFAHAIITALAVADAEGAVSGPIELELFHAHAIESDDTSCVRFRSSTGVPISIAVTLCAAEHRPPQLVVHGETGRIIFEYTLDRVTLDRDSADPVTTVYPRTGLMENLVAHITREVPLLVPPEATRGFMTVLEAVRCAPDPRPIPESAQQVSVTAEGTRRIVSGIDELVHRSASHIALFSELDAPWASMTEVAP GT:EXON 1|1-384:0| BL:SWS:NREP 2 BL:SWS:REP 53->122|YHHX_ECOLI|2e-07|34.3|70/345| BL:SWS:REP 247->364|LEXA_LACRJ|8e-04|28.3|113/208| SEG 143->158|iadgaigavrgiggag| SEG 174->186|grrrldgrdvvdg| BL:PDB:NREP 1 BL:PDB:REP 53->122|3f4lA|7e-08|34.3|70/340| RP:PDB:NREP 1 RP:PDB:REP 6->290|3dtyB|5e-19|16.5|260/351| RP:PFM:NREP 1 RP:PFM:REP 18->127|PF01408|4e-10|40.6|106/119|GFO_IDH_MocA| HM:PFM:NREP 2 HM:PFM:REP 9->128|PF01408|9.8e-16|35.0|117/120|GFO_IDH_MocA| HM:PFM:REP 140->201|PF02894|0.00091|21.4|56/115|GFO_IDH_MocA_C| GO:PFM:NREP 1 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01408|IPR000683| RP:SCP:NREP 1 RP:SCP:REP 7->142|1ydwA1|2e-12|19.5|133/172|c.2.1.3| HM:SCP:REP 6->188|1tltA1|3.9e-29|33.3|165/167|c.2.1.3|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 132->325|2nvwA2|2e-10|21.2|189/0|d.81.1.5|1/1|Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain| OP:NHOMO 44 OP:NHOMOORG 38 OP:PATTERN --------1111111----------------------------------1------------------ --------------------------------------------112-----322-----------11111---------------------------------------------------------------1--11----------------------------------------------------------------------2------------1----------------------------------------------------------------------------------------------------1----------------------------------------------------------------11-111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-1-1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 362 STR:RPRED 94.3 SQ:SECSTR #ccEccEEEEEcccTTcHHHHHHHHHHHGGGcEEEEEEEccccHHHHHHHHHHTTccHHHHHHHHTcTTcccEEEEcccGGGHHHHHHHHHHTTcEEEEcccccccHHHHHHHHHHHHHTTccEEEccGGGGcHHHHHHHHHHHTTTTccHTTTTccEEEEEEEccTTcccTTcccTTHHHHTcccHHHHTTHHHHHHHHHcTTccEEEEEEEEcccGGGTTccccEEEEEEETTccEEEEEcccccEcTTcccEEEEEEEccEEEEEETcTTEEEEEETTcccEEEETTcccHHHHHHHHHTTcccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccTTTTccH##################### DISOP:02AL 1-4, 376-384| PSIPRED cccccEEEEEEEEEcHHHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHcccccEEccHHHHHccccccEEEEEcccHHHHHHHHHHHHccccEEEcccccccHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHccccccEEEEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccHHEEEEEEEccccccccccccEEEEEEEEcccEEEEEEEEEEcccccccEEEEEEccEEEEEEccccEEEEEEcccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccccccccccccc //