[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55746.1
DDBJ      :             transcriptional regulator, GntR family
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  362/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5a.78.1
:226 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->216 2hs5A PDBj 7e-11 28.1 %
:RPS:PDB   1->214 3c7jA PDBj 2e-20 22.7 %
:RPS:SCOP  10->74 1e2xA1  a.4.5.6 * 4e-13 26.2 %
:RPS:SCOP  51->214 1e2xA2  a.78.1.1 * 3e-12 13.9 %
:HMM:SCOP  4->108 1v4rA1 a.4.5.6 * 8.1e-15 32.7 %
:RPS:PFM   164->208 PF10345 * Cohesin_load 7e-04 39.5 %
:HMM:PFM   83->206 PF07729 * FCD 3.2e-22 30.6 124/125  
:HMM:PFM   14->74 PF00392 * GntR 1.9e-20 44.3 61/64  
:BLT:SWISS 13->220 GNTR_BACLI 2e-26 31.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55746.1 GT:GENE AAZ55746.1 GT:PRODUCT transcriptional regulator, GntR family GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1991655..1992335 GB:FROM 1991655 GB:TO 1992335 GB:DIRECTION + GB:PRODUCT transcriptional regulator, GntR family GB:PROTEIN_ID AAZ55746.1 GB:DB_XREF GI:71915844 InterPro:IPR000524 LENGTH 226 SQ:AASEQ MPEISPIRPQALGDQVASELRRLIITGRYAPGTPLVESHLAAQFDLSRGPIRDALKILAAEGLIDTNRRSATVVGLSGADIDELFSLREAMERLALRIALDRDRASLVAGLNRALHAMRRAAEEHDPTAFTAADLRFHSVFYDVAEHRRLGDVWAQYRPTIEMLLLASNERYTDLTPSVRAHELLARLIEEGNPEAVFAELHEHLDNARRRLRQPYTAQETTSAQE GT:EXON 1|1-226:0| BL:SWS:NREP 1 BL:SWS:REP 13->220|GNTR_BACLI|2e-26|31.7|208/243| SEG 93->107|rlalrialdrdrasl| BL:PDB:NREP 1 BL:PDB:REP 15->216|2hs5A|7e-11|28.1|192/205| RP:PDB:NREP 1 RP:PDB:REP 1->214|3c7jA|2e-20|22.7|207/232| RP:PFM:NREP 1 RP:PFM:REP 164->208|PF10345|7e-04|39.5|43/580|Cohesin_load| HM:PFM:NREP 2 HM:PFM:REP 83->206|PF07729|3.2e-22|30.6|124/125|FCD| HM:PFM:REP 14->74|PF00392|1.9e-20|44.3|61/64|GntR| RP:SCP:NREP 2 RP:SCP:REP 10->74|1e2xA1|4e-13|26.2|65/73|a.4.5.6| RP:SCP:REP 51->214|1e2xA2|3e-12|13.9|144/149|a.78.1.1| HM:SCP:REP 4->108|1v4rA1|8.1e-15|32.7|98/0|a.4.5.6|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 749 OP:NHOMOORG 372 OP:PATTERN ------1-11-11111-1-------------------------------------------------- 1-2-21----1---21-11-11--181-1111111134E9---133---12-44711-----3-42A1411-----------4-----------------------------------------------------12222----------------------------1---------------211-1-4-211111--1-111--13-331211----121-11111--4-1111111111111111111----------------------------------------------------------------------21211----------21-------11---1312112211--12---1---1--1--------22744--32--2133233333236-2242263476--86652453135542--11234233-14---------111---1------------------------------------3324334342-222244962222114176A66222213232362B194111----1-----------312--2-------211--111-121---------2-----------------------------1-11-11-321111-11111111-1111----1--------111--1-1111111111-1111211121111111111222---1-1-1-1111111-1--1-1111111---11111111111--------------1122----------------------1--1------21311311-222-------------111111------------------------------------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 221 STR:RPRED 97.8 SQ:SECSTR HHccccccGGGHHHHHHHHHHHHHHTccccTTccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEETTTEEEEccHHHHHHHHHHHHHHHHHHHHHHHGGGccHHHHHHHHHHHHHHHHcHHTcccHHHHHHHHHHHHHHTTTcccHHHHHHHHHHHHHHHHHHHHHHHcGcccccccHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHTcGcccc##### DISOP:02AL 1-11, 215-226| PSIPRED cccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHccccHHHHHHHHHHHHccEEEEccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //