[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55773.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:140 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55773.1 GT:GENE AAZ55773.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 2026381..2026803 GB:FROM 2026381 GB:TO 2026803 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ55773.1 GB:DB_XREF GI:71915871 LENGTH 140 SQ:AASEQ MMSTTASQPVRLNALEIGIIALVSDSHALARCGRPMALSVAGHDHHIVSVQPVDAPLWTPLISRDAALAALPGRDASADEVLAAVAALARRIAPPGHLVDVGARGVFVDAAAKTRIPAPVVITPQEEWGAVRAVVSRWAA GT:EXON 1|1-140:0| SEG 75->93|dasadevlaavaalarria| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8| PSIPRED cccccccccEEEEEEEEEEEEEEEccHHHHHccccEEEEEEccccEEEEEEEccccHHHHHHccccEEEEcccccccHHHHHHHHHHHHHHccccccEEEEcccEEEEEccccccccccEEEEcHHHHHHHHHHHHHHcc //