[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55801.1
DDBJ      :             Conserved hypothetical protein 147
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  277/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
e.52.1
:291 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   84->269 2qv7A PDBj 8e-07 28.1 %
:RPS:PDB   35->286 2bonA PDBj 6e-28 20.5 %
:RPS:SCOP  2->289 2qv7A1  e.52.1.2 * 4e-43 18.8 %
:HMM:SCOP  4->91 1u0tA_ e.52.1.1 * 0.00038 23.9 %
:RPS:PFM   83->113 PF00781 * DAGK_cat 4e-04 54.8 %
:HMM:PFM   4->125 PF00781 * DAGK_cat 1.1e-25 32.8 119/129  
:BLT:SWISS 73->288 DAGK_MYCTU 1e-35 39.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55801.1 GT:GENE AAZ55801.1 GT:PRODUCT Conserved hypothetical protein 147 GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2065404..2066279) GB:FROM 2065404 GB:TO 2066279 GB:DIRECTION - GB:PRODUCT Conserved hypothetical protein 147 GB:PROTEIN_ID AAZ55801.1 GB:DB_XREF GI:71915899 InterPro:IPR001206 InterPro:IPR005218 LENGTH 291 SQ:AASEQ MPTVTLLVNPASGRRRAAVVASALRERLRARGAQVRLLMGESAGDSARLVDQLVAQRPDVLVTVGGDGLVHLALQAVVGTDIPLGVVGAGTGNDIARELGLPRAPDAAAQAILAGHTRQVDTVHVAGRHYLSVLACGFDSRVNERVNRFRRSLGRLDYVAGVLAELGAFTPLDYTVDVDGQRVQTTGMLVAVANTRCYGGGMLICPQARPDDGLLDVIVVREVGRLRFLRLFPRVFTGSHLELPEVTVLRGRHVSLSVAGDVVAHADGERLAAPPLVCEVRPGSVRMVTDH GT:EXON 1|1-291:0| BL:SWS:NREP 1 BL:SWS:REP 73->288|DAGK_MYCTU|1e-35|39.1|215/309| SEG 11->33|asgrrraavvasalrerlrarga| SEG 59->70|dvlvtvggdglv| SEG 225->236|rlrflrlfprvf| BL:PDB:NREP 1 BL:PDB:REP 84->269|2qv7A|8e-07|28.1|167/293| RP:PDB:NREP 1 RP:PDB:REP 35->286|2bonA|6e-28|20.5|239/287| RP:PFM:NREP 1 RP:PFM:REP 83->113|PF00781|4e-04|54.8|31/126|DAGK_cat| HM:PFM:NREP 1 HM:PFM:REP 4->125|PF00781|1.1e-25|32.8|119/129|DAGK_cat| GO:PFM:NREP 2 GO:PFM GO:0004143|"GO:diacylglycerol kinase activity"|PF00781|IPR001206| GO:PFM GO:0007205|"GO:activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway"|PF00781|IPR001206| RP:SCP:NREP 1 RP:SCP:REP 2->289|2qv7A1|4e-43|18.8|276/299|e.52.1.2| HM:SCP:REP 4->91|1u0tA_|0.00038|23.9|88/302|e.52.1.1|1/1|NAD kinase| OP:NHOMO 403 OP:NHOMOORG 286 OP:PATTERN --------------------------------------------------------------1----- -2-11---------11111-11--111-111111111111-1113111----23311---213-11311111---11111112-----1111-111-------1-1-1-2---------------111111-11-122212111311232111--11-------1-22222------------1221111--13222222222222222122232222222213233333321222222222222222122222---11-1----1---12-3---------1111------------------------------------1-121111111111111---111111-112----22----11--111-1--1-----1--------11---1--------------1-11111111213----1---------1----------------------11-2111--------------------------------1-----------------------------------------------------------------------------------------------1-112212---------------------------------1--1---------1-11--1----1----1-------------------1-----------------------------22----------------------1----------------------------1-1-1-1-----------------------------------11------1---------------------1---1-----------------11------------------------------------------1--1-11111- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1-----41-----11--1-------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 253 STR:RPRED 86.9 SQ:SECSTR #################################EEEEEEcccTTHHHHHHHHHHHHTccEEEEEEcHHHHHHHHHHHHHcccEEEEEEcccccHHHHHTTccccHHHHHHHHHHcEEEEEEEEEETTccEccEEEEEEEEEcccHHHHHHHHHTcHHHHHTTTTcEEEEEcEEEEEEETTEEEEEEEcEEEEEcccccTTTccccTTccTTcccEEEEEEccccccHHHHHHHHHTTHTTcccTTEEEEEEcEEEEEEEEEEEEEETTEEEEEEEEEEEEEEEEEE##### PSIPRED ccEEEEEEccccccccHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHcccccEEEEEcccHHHHHHHHcccccHHHHHHHHHcccEEEEccEEEccccEEEEEEccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccEEEEEEEcEEEEccEEEEEEEccccccccccccccccccccEEEEEEEccccHHHHHHHHHHHHcccccccccEEEEEEEEEEEEEcccEEEEEcccccccccEEEEEEcccEEEEEcc //