[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55805.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:82 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   28->55 PF07638 * Sigma70_ECF 6.1e-05 32.1 28/185  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55805.1 GT:GENE AAZ55805.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2068013..2068261) GB:FROM 2068013 GB:TO 2068261 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ55805.1 GB:DB_XREF GI:71915903 LENGTH 82 SQ:AASEQ MLWTVAVLIVAAGALAAGACAVQSCTGAQELANELRVAHAAVGKRWDLLRAAVRETSHHPPAGRVARPGRTIGGAGSAAQRG GT:EXON 1|1-82:0| TM:NTM 1 TM:REGION 3->25| SEG 5->22|vavlivaagalaagacav| HM:PFM:NREP 1 HM:PFM:REP 28->55|PF07638|6.1e-05|32.1|28/185|Sigma70_ECF| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 76-82| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccc //