[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55809.1
DDBJ      :             putative Lsr2-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  59/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:107 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->100 PF11774 * Lsr2 1e-21 54.0 %
:HMM:PFM   1->102 PF11774 * Lsr2 6.3e-43 52.9 102/110  
:BLT:SWISS 1->104 LSR2_MYCTU 1e-17 43.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55809.1 GT:GENE AAZ55809.1 GT:PRODUCT putative Lsr2-like protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2072855..2073178) GB:FROM 2072855 GB:TO 2073178 GB:DIRECTION - GB:PRODUCT putative Lsr2-like protein GB:PROTEIN_ID AAZ55809.1 GB:DB_XREF GI:71915907 LENGTH 107 SQ:AASEQ MARKTVIELIDDLDGSKADETVTFGIDGVTYEIDLSADHAEDLRSIFEAYVKAGRKVANRPRRKSRTPKVDTRAVRKWAQAQGYEVSERGRIPQHILDAYQKRTGDA GT:EXON 1|1-107:0| BL:SWS:NREP 1 BL:SWS:REP 1->104|LSR2_MYCTU|1e-17|43.3|104/112| RP:PFM:NREP 1 RP:PFM:REP 1->100|PF11774|1e-21|54.0|100/110|Lsr2| HM:PFM:NREP 1 HM:PFM:REP 1->102|PF11774|6.3e-43|52.9|102/110|Lsr2| OP:NHOMO 102 OP:NHOMOORG 60 OP:PATTERN -------------------------------------------------------------------- ----111----11111111-1211111111111111338411143211123-231111--33112332224---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------ DISOP:02AL 54-74, 105-107| PSIPRED ccEEEEEEEEEccccccccEEEEEEEccEEEEEEEcHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHccc //