[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55835.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:63 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   7->59 PF04149 * DUF397 2e-10 51.9 %
:HMM:PFM   6->60 PF04149 * DUF397 4.2e-25 57.4 54/56  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55835.1 GT:GENE AAZ55835.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2103405..2103596) GB:FROM 2103405 GB:TO 2103596 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ55835.1 GB:DB_XREF GI:71915933 LENGTH 63 SQ:AASEQ MHSPNVQWRKSSYSGSGDNCVEVAETPEAVVFVRDTQNRHLGYLKFSAQEWTAFLHTLKAGQV GT:EXON 1|1-63:0| RP:PFM:NREP 1 RP:PFM:REP 7->59|PF04149|2e-10|51.9|52/55|DUF397| HM:PFM:NREP 1 HM:PFM:REP 6->60|PF04149|4.2e-25|57.4|54/56|DUF397| OP:NHOMO 9 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------1----1----7---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 8-18, 62-63| PSIPRED cccccccEEEcccccccccEEEEEcccccEEEEEccccccccEEEEcHHHHHHHHHHHHcccc //