Thermobifida fusca YX (tfus0)
Gene : AAZ55840.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:89 amino acids
:HMM:PFM   66->80 PF08428 * Rib 0.00014 60.0 15/65  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55840.1 GT:GENE AAZ55840.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 2106444..2106713 GB:FROM 2106444 GB:TO 2106713 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ55840.1 GB:DB_XREF GI:71915938 LENGTH 89 SQ:AASEQ MSTAVTDAFPLGRDENRNDQVTEWRPFGMRYGVQPTPIPVPLSDTKYDPDQQVLVVADGQPCAKIERAGTMRVTYPDGQKPGQSDVEKD GT:EXON 1|1-89:0| HM:PFM:NREP 1 HM:PFM:REP 66->80|PF08428|0.00014|60.0|15/65|Rib| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 77-89| PSIPRED ccccccccccccccccccccccEEEcccEEcccccccccccccccccccccEEEEEEccccccEEccccEEEEEccccccccccccccc //