[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55844.1
DDBJ      :             Polyphosphate glucokinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  81/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:262 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   67->240 1woqA PDBj 4e-52 56.1 %
:RPS:PDB   9->132 1bu6O PDBj 2e-06 11.4 %
:RPS:PDB   156->255 3bp8B PDBj 4e-14 13.3 %
:RPS:SCOP  9->130 1woqA1  c.55.1.10 * 9e-15 45.1 %
:RPS:SCOP  151->249 1woqA2  c.55.1.10 * 2e-26 64.3 %
:HMM:SCOP  5->259 1sz2A1 c.55.1.7 * 7.2e-33 37.6 %
:RPS:PFM   10->132 PF00480 * ROK 4e-05 33.3 %
:HMM:PFM   10->162 PF00480 * ROK 2.7e-18 32.0 147/179  
:BLT:SWISS 23->249 PPGK_MYCTU 4e-50 45.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55844.1 GT:GENE AAZ55844.1 GT:PRODUCT Polyphosphate glucokinase GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 2111660..2112448 GB:FROM 2111660 GB:TO 2112448 GB:DIRECTION + GB:PRODUCT Polyphosphate glucokinase GB:PROTEIN_ID AAZ55844.1 GB:DB_XREF GI:71915942 LENGTH 262 SQ:AASEQ MASRGRVGLGIDIGGSGIKGAPVDLDRGTFVVDRVKIATPQPATPEAVAAVVAEIVTAFADDVPQDAPLGVTFPAVIQHGVARSAANVDRSWIGTNVEELLSAVTGRRVLVVNDADAAAMAEHRYGAASGVDGVVLLTTLGTGIGTAVLVDGVLLPNTEFGHLEIDGYDAETRASASAKERENLSYKEWAEERLQRYYSVIEDLLWPDLIVVGGGVSRKADKFLPHLRLRAPIVPAKLRNTAGIVGAAVLAAERLGGDRVSA GT:EXON 1|1-262:0| BL:SWS:NREP 1 BL:SWS:REP 23->249|PPGK_MYCTU|4e-50|45.0|222/265| SEG 38->60|atpqpatpeavaavvaeivtafa| SEG 133->150|gvvllttlgtgigtavlv| BL:PDB:NREP 1 BL:PDB:REP 67->240|1woqA|4e-52|56.1|173/253| RP:PDB:NREP 2 RP:PDB:REP 9->132|1bu6O|2e-06|11.4|114/497| RP:PDB:REP 156->255|3bp8B|4e-14|13.3|98/380| RP:PFM:NREP 1 RP:PFM:REP 10->132|PF00480|4e-05|33.3|120/181|ROK| HM:PFM:NREP 1 HM:PFM:REP 10->162|PF00480|2.7e-18|32.0|147/179|ROK| RP:SCP:NREP 2 RP:SCP:REP 9->130|1woqA1|9e-15|45.1|122/129|c.55.1.10| RP:SCP:REP 151->249|1woqA2|2e-26|64.3|98/124|c.55.1.10| HM:SCP:REP 5->259|1sz2A1|7.2e-33|37.6|242/0|c.55.1.7|1/1|Actin-like ATPase domain| OP:NHOMO 85 OP:NHOMOORG 81 OP:PATTERN -------------------------------------------------------------------- -----11111111111111-11111111111111111111-11111111221121111----1111111111111111----1--------------------11---------------------------------------2----------------------111-------------111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 257 STR:RPRED 98.1 SQ:SECSTR ####ccEEEEEEEcccEEEEEEEcTTccEEEEEEEEEEccccccHHHHHHHHHHHHTTTGGGccEEEEEEccEEETTEEEcccGGGGGGcEGTTccHHHHHHHHHcccEEEEEHHHHHHHHHHHTccTTcccEEEcccEEEEEEETTEEEccTTccccTTccccccHHHHHHHHTTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcGGGGGTTTcHHHHHTTccEEEccccccccTHHHHHHHHccHccGGGT# DISOP:02AL 1-4, 259-262| PSIPRED ccccccEEEEEEEcccEEEEEEEEccccEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccEEEEEEEcccEEEccEEEEccccccccccccHHHHHHHHHcccEEEEEcHHHHHHHHHHHccccccccEEEEEEcccEEEEEEEEccEEccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcHHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHccccccc //