[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55862.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.118.8
:161 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  48->159 1qqeA_ a.118.8.1 * 0.00037 23.2 %
:HMM:PFM   113->141 PF07719 * TPR_2 0.00091 24.1 29/34  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55862.1 GT:GENE AAZ55862.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2133380..2133865) GB:FROM 2133380 GB:TO 2133865 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ55862.1 GB:DB_XREF GI:71915960 LENGTH 161 SQ:AASEQ MAELPLTEYAPRPRPAAASPEPLPEPLADTWQDLLDQAEQWRRTWRKEQARAAWRRFDELTVGVELPSWARGRRAEAEGWFHDMDGDHAAAVEHYRAAADHYAAAQLDADRHRVLSLLGQSLAEDGNRTEGLALLQQAVAYLDEHGTPTQRVGARIRLAAH GT:EXON 1|1-161:0| SEG 10->28|aprprpaaaspeplpepla| SEG 88->110|haaavehyraaadhyaaaqldad| HM:PFM:NREP 1 HM:PFM:REP 113->141|PF07719|0.00091|24.1|29/34|TPR_2| HM:SCP:REP 48->159|1qqeA_|0.00037|23.2|112/290|a.118.8.1|1/1|TPR-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 13-21, 160-161| PSIPRED cccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHccccEEccc //