[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55866.1
DDBJ      :             similar to Uncharacterized conserved protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  47/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.1.16
:273 amino acids
:PSIPRED
:RPS:SCOP  114->210 1fvpA  c.1.16.2 * 8e-04 12.5 %
:RPS:PFM   1->173 PF05742 * DUF833 4e-10 37.0 %
:HMM:PFM   1->78 PF05742 * DUF833 1.6e-11 34.2 73/273  
:BLT:SWISS 1->59 T10_MOUSE 3e-04 42.1 %
:BLT:SWISS 34->238 COAX_BURXL 9e-05 34.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55866.1 GT:GENE AAZ55866.1 GT:PRODUCT similar to Uncharacterized conserved protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2138507..2139328) GB:FROM 2138507 GB:TO 2139328 GB:DIRECTION - GB:PRODUCT similar to Uncharacterized conserved protein GB:PROTEIN_ID AAZ55866.1 GB:DB_XREF GI:71915964 LENGTH 273 SQ:AASEQ MCTAIVGFDPTAPVPIVLAALRDEMVDRPFDRPGQHWPQWPHLIGGRDAQAGGTWLAVAPPESATPRVAAILNGRVEKLTATGRRPVFDSTVPPGVTRRSRGELPLRAAATGTLGLGRDELRAFDPFHLVIADPEQAALVSWDGSDLTEEKLAPGVTVVVNTGLDATAPRAAQHGPRFAATRPAPSEDVLRTSSDIREIWGDWVRLLDEAAADTAHSASGGGDDRTSLVARLELPDGRVWATNSVTLLALTLTVLRYAFTDTPGDPAAWSLIR GT:EXON 1|1-273:0| BL:SWS:NREP 2 BL:SWS:REP 1->59|T10_MOUSE|3e-04|42.1|57/100| BL:SWS:REP 34->238|COAX_BURXL|9e-05|34.4|180/270| SEG 245->255|vtllaltltvl| RP:PFM:NREP 1 RP:PFM:REP 1->173|PF05742|4e-10|37.0|154/261|DUF833| HM:PFM:NREP 1 HM:PFM:REP 1->78|PF05742|1.6e-11|34.2|73/273|DUF833| RP:SCP:NREP 1 RP:SCP:REP 114->210|1fvpA|8e-04|12.5|96/231|c.1.16.2| OP:NHOMO 50 OP:NHOMOORG 50 OP:PATTERN ----------------------------1--1------------------------------------ ----1-----------------------------------------------------------------1-------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-1111------------------------------------1111---------------------------------------------11----1-------------1-------------------------1---------------------------------------1-----1111--11111111-1-----------------------------------------------------------------------------------------------------------------11-------------------------11-----1111111111---------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEEEEEEcccccccEEEEEccHHHHccHHHHHHHHHcccccEEEcccccccccEEEEccccccccEEEEEEEcccccccccccccccccccccccccccccccccHHccccHHHHHHHHHHccccEEEEEEEccccEEEEEcccccccEEEcccEEEEEccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccHHHcccccccccccccccccccHHHHEEEEEcccccccccHHHHHHHHHHHHHHHHHHHcccccccccccc //