[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55893.1
DDBJ      :             iron-chelator utilization protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  257/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
b.43.4
:273 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->273 2gpjA PDBj 3e-25 36.2 %
:RPS:PDB   14->248 1cqxA PDBj 2e-09 11.3 %
:RPS:SCOP  20->136 1ep1B1  b.43.4.2 * 2e-09 21.1 %
:HMM:SCOP  5->140 1i7pA1 b.43.4.2 * 1.1e-13 26.5 %
:RPS:PFM   22->135 PF08021 * FAD_binding_9 4e-20 52.2 %
:RPS:PFM   140->259 PF04954 * SIP 6e-23 56.4 %
:HMM:PFM   140->259 PF04954 * SIP 6.2e-39 49.6 119/119  
:HMM:PFM   21->134 PF08021 * FAD_binding_9 2.4e-35 43.0 114/117  
:BLT:SWISS 12->266 VIUB_VIBCH 3e-30 34.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55893.1 GT:GENE AAZ55893.1 GT:PRODUCT iron-chelator utilization protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2168511..2169332) GB:FROM 2168511 GB:TO 2169332 GB:DIRECTION - GB:PRODUCT iron-chelator utilization protein GB:PROTEIN_ID AAZ55893.1 GB:DB_XREF GI:71915991 LENGTH 273 SQ:AASEQ MTATVTERTVEMYPLKSRLLEVVNVRRITPRMVRVDLGGSDIAGLRSDNFADHVKLWFPNPETGEHVLPVVEDDRCLNFRAPGVIYRDYTVRRFDAKAGLLTIDFVVHDNGPGGRWAATAQPGDRLGVLGPRGTVYYPEADHYVLLADETALPAAARRIEELPRDASVTAFFEVADAAEEQELDAPEGAEITWLHRNGAAPGTTDLLLRALEQTEFPKGRVFVWAGGEADALKPIRRLLKERGLVRGRDFEVDGYWRRGVSNLDHHAADDDDE GT:EXON 1|1-273:0| BL:SWS:NREP 1 BL:SWS:REP 12->266|VIUB_VIBCH|3e-30|34.1|246/271| BL:PDB:NREP 1 BL:PDB:REP 18->273|2gpjA|3e-25|36.2|229/240| RP:PDB:NREP 1 RP:PDB:REP 14->248|1cqxA|2e-09|11.3|222/403| RP:PFM:NREP 2 RP:PFM:REP 22->135|PF08021|4e-20|52.2|113/117|FAD_binding_9| RP:PFM:REP 140->259|PF04954|6e-23|56.4|117/118|SIP| HM:PFM:NREP 2 HM:PFM:REP 140->259|PF04954|6.2e-39|49.6|119/119|SIP| HM:PFM:REP 21->134|PF08021|2.4e-35|43.0|114/117|FAD_binding_9| RP:SCP:NREP 1 RP:SCP:REP 20->136|1ep1B1|2e-09|21.1|95/101|b.43.4.2| HM:SCP:REP 5->140|1i7pA1|1.1e-13|26.5|113/125|b.43.4.2|1/1|Riboflavin synthase domain-like| OP:NHOMO 369 OP:NHOMOORG 259 OP:PATTERN -------------------------------------------------------------------- ----32-244211233311-12--2411111222221944121225222221422111--221-5342381-----------------------------------------------------------------------------------------------------------------12-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-----------------2--1-----------1---------2---322----121112-----131------11111111-11-----------------------------------------11-11111111111111111111-11111111--111-----2-1-1--1----11--------------1---------------------------11-----------------------------11-1-1--21--1111-1-1111----1---------------2211-121111111111-11111111111111111111111211111111111111111112111---12-1--------------------------1-2---------------11111----1--11122221-1211-111-----------11111111112112311111------------------------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 267 STR:RPRED 97.8 SQ:SECSTR ######cccccccccccEEEEEEEEEEccccEEEEEEEETTccccccccTTcEEEEEEEETTTTEEEEEEEHHcccEcccccccccEEEEEEccTTcccEEcccTTccccHHHHHHHHHccTTcEEEEccccccccccTcccEEEEEccccHHHHHHHHHHHTccccEEEEEEEcccccHHHHHHcTTEEEEEEEccccTTcEEccccGGGcHHHHccTTcEEEEEccHHHHHHHHHHHHHTTccGGGcHHEEEEEcTTccHHHHHHHHHHHH DISOP:02AL 1-6, 265-273| PSIPRED ccccccccccEEccccEEEEEEEEEEEEcccEEEEEEEcccHHcccccccccEEEEEEcccccccccccEEccccccccccccccccccEEEEccccccEEEEEEEEccccHHHHHHHHcccccEEEEEccccccccccccEEEEEEccHHHHHHHHHHHHccccccEEEEEEEccHHHHHccccccccEEEEEEccccccccHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHHHccccHHHcEEEEEccccccHHHHHHHHHccc //