[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55907.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:244 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   21->108 PF09323 * DUF1980 2.2e-09 21.2 85/182  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55907.1 GT:GENE AAZ55907.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2197332..2198066) GB:FROM 2197332 GB:TO 2198066 GB:DIRECTION - GB:PRODUCT putative membrane protein GB:PROTEIN_ID AAZ55907.1 GB:DB_XREF GI:71916005 LENGTH 244 SQ:AASEQ MNRLAQGMVMVLLGAAALSVTVASQDYLNYVRGEFRPFLIAAGAVLVLLGLVAVVAELRSPEDEAEPGHDPAHGHNHGRAPVVAWLLLLPVVVIFVVAPPALGAYTAAAADPAAAVERALPDDVPADTPDADGPVEMSLREFVVRAWTDEERSMAGREIRLTGFAVPNPDGEGWYLARLQIACCAADAIVNRVLIVNQEEPPADSWWTVTGRWVEPEGDIRRVRDHRFEVTEMVPVDHPPDPYE GT:EXON 1|1-244:0| TM:NTM 3 TM:REGION 5->27| TM:REGION 37->59| TM:REGION 88->109| SEG 39->56|liaagavlvllglvavva| SEG 80->119|apvvawllllpvvvifvvappalgaytaaaadpaaavera| SEG 121->135|pddvpadtpdadgpv| HM:PFM:NREP 1 HM:PFM:REP 21->108|PF09323|2.2e-09|21.2|85/182|DUF1980| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------11--1--1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 58-76, 234-244| PSIPRED cccHHHHHHHHHHHHHHHEEEEHHHHHHHHHHcccccEEHHHHHHHHHHHHEEEEEccccccccccccccccccccccccccEEEEEcccEEEEEEEccccccccccccccHHHHHHHcccccccccccccccccEEEHHHHHHHHcccccccccccEEEEEEEEEEccccccEEEEEEEEEEEEEccEEEEEEEEcccccccccEEEEEEEEEEEEEcccccEEEEEEEEEEEEccccccccc //