[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55916.1
DDBJ      :             putative regulatory protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  44/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:99 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   18->84 PF02467 * Whib 8e-09 50.0 %
:HMM:PFM   18->86 PF02467 * Whib 6.3e-24 59.4 64/66  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55916.1 GT:GENE AAZ55916.1 GT:PRODUCT putative regulatory protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 2206560..2206859 GB:FROM 2206560 GB:TO 2206859 GB:DIRECTION + GB:PRODUCT putative regulatory protein GB:PROTEIN_ID AAZ55916.1 GB:DB_XREF GI:71916014 LENGTH 99 SQ:AASEQ MSQVRRQATLRPRPSWGWQDAAACRGEDLVLFFGPDGERQPEREIRERKAKEICAHCPVRTECLDYAISRPEKYGTWGGLNEDERASERRRRMRRANAA GT:EXON 1|1-99:0| SEG 42->53|ereirerkakei| SEG 85->98|raserrrrmrrana| RP:PFM:NREP 1 RP:PFM:REP 18->84|PF02467|8e-09|50.0|62/66|Whib| HM:PFM:NREP 1 HM:PFM:REP 18->86|PF02467|6.3e-24|59.4|64/66|Whib| OP:NHOMO 80 OP:NHOMOORG 44 OP:PATTERN -------------------------------------------------------------------- ----51-111111-11111-1-111-111111111112F9-2-131-11---------------3212221---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11, 89-99| PSIPRED cccccccccccccccccHHHHHHcccccccccccccccccccccHHHHHHHHHHcccccHHHHHHHHHHcccccEEEccccHHHHHHHHHHHHcccccc //