[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55924.1
DDBJ      :             glycogen debranching enzyme GlgX
Swiss-Prot:             

Homologs  Archaea  12/68 : Bacteria  571/915 : Eukaryota  61/199 : Viruses  0/175   --->[See Alignment]
b.1.18b.71.1c.1.8
:707 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->671 2vuyB PDBj 0.0 51.9 %
:RPS:PDB   5->699 2e8yA PDBj 3e-73 21.2 %
:RPS:SCOP  32->82 2qlvB1  b.1.18.21 * 2e-04 11.8 %
:RPS:SCOP  58->555 2fhbA5  c.1.8.1 * 3e-70 16.5 %
:RPS:SCOP  593->700 1bf2A2  b.71.1.1 * 6e-11 26.3 %
:HMM:SCOP  8->150 1bf2A1 b.1.18.2 * 2.5e-49 57.6 %
:HMM:SCOP  141->581 1bf2A3 c.1.8.1 * 7e-129 38.2 %
:HMM:SCOP  590->700 1bf2A2 b.71.1.1 * 1.3e-26 48.0 %
:RPS:PFM   14->98 PF02922 * CBM_48 4e-07 51.3 %
:RPS:PFM   191->529 PF00128 * Alpha-amylase 1e-26 45.4 %
:HMM:PFM   13->99 PF02922 * CBM_48 2e-25 46.8 79/84  
:HMM:PFM   193->532 PF00128 * Alpha-amylase 7.3e-18 21.9 270/316  
:BLT:SWISS 6->699 GLGX_MYCTU 0.0 63.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55924.1 GT:GENE AAZ55924.1 GT:PRODUCT glycogen debranching enzyme GlgX GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 2216031..2218154 GB:FROM 2216031 GB:TO 2218154 GB:DIRECTION + GB:PRODUCT glycogen debranching enzyme GlgX GB:PROTEIN_ID AAZ55924.1 GB:DB_XREF GI:71916022 InterPro:IPR006589 InterPro:IPR011837 LENGTH 707 SQ:AASEQ MPMVEVWPGHAYPLGATYDGSGTNFSLFSEVATGVELCLFDDDGAETRVPLTEQDGHVWHGYLPTVGPGQRYGYRVHGPYDPERGLRCNPNKLLVDPYAKAIDGQIHWHESLFDYHFADPGRVNNHDSAPYVPTCVVVSPFFDWGAEQHPNIPYHETVIYEAHVRGMTIRHPDVPPPLRGTYAGMAHPAIIEHLLSLGVTAVELMPIHHFLPEHALVARGLTNYWGYNTLAFFAPHSGYAATGTRGHQVQEFKTMVKALHQAGIEVILDVVYNHTAEGDHMGPALSLRGIDNLAYYRVREDNPRYYLDYTGCGNSLNVRHPHSLQLIMDSLRYWVLDMHVDGFRFDLAAALAREFHDVDRLSTFFDIVQQDPVISQVKLIAEPWDVGPGGYQVGNFPPLWTEWNGKYRDTVRDFWRGYPVLPELASRISGSSDLYQADGRRPVASINFVTCHDGFTLADLVSYDRKHNEANGEDNRDGTDDNRSWNHGTEGPTTDSAIATLRRRQMRNMLTTLMLSQGVPMLSHGDEIGRTQHGNNNAYCQDNPISWVDWELARRNADLLDFVRTLSRLRREHPVFRRRRFFQGALPGRGKQRDIAWLRPDGTLMEDADWGRGWRALGVFLNGDAITEPDRMGRRIRDDSFLLLLNAGINDVQFTLPGPSYSAAWETVVDTADPEVAGRPYLPAGSDVTVIDRSFLVLKGVTKALPS GT:EXON 1|1-707:0| BL:SWS:NREP 1 BL:SWS:REP 6->699|GLGX_MYCTU|0.0|63.7|694/721| SEG 568->582|rlrrehpvfrrrrff| BL:PDB:NREP 1 BL:PDB:REP 8->671|2vuyB|0.0|51.9|659/711| RP:PDB:NREP 1 RP:PDB:REP 5->699|2e8yA|3e-73|21.2|604/712| RP:PFM:NREP 2 RP:PFM:REP 14->98|PF02922|4e-07|51.3|76/82|CBM_48| RP:PFM:REP 191->529|PF00128|1e-26|45.4|260/296|Alpha-amylase| HM:PFM:NREP 2 HM:PFM:REP 13->99|PF02922|2e-25|46.8|79/84|CBM_48| HM:PFM:REP 193->532|PF00128|7.3e-18|21.9|270/316|Alpha-amylase| GO:PFM:NREP 5 GO:PFM GO:0004553|"GO:hydrolase activity, hydrolyzing O-glycosyl compounds"|PF02922|IPR004193| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF02922|IPR004193| GO:PFM GO:0003824|"GO:catalytic activity"|PF00128|IPR006047| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF00128|IPR006047| GO:PFM GO:0043169|"GO:cation binding"|PF00128|IPR006047| RP:SCP:NREP 3 RP:SCP:REP 32->82|2qlvB1|2e-04|11.8|51/87|b.1.18.21| RP:SCP:REP 58->555|2fhbA5|3e-70|16.5|479/563|c.1.8.1| RP:SCP:REP 593->700|1bf2A2|6e-11|26.3|99/113|b.71.1.1| HM:SCP:REP 8->150|1bf2A1|2.5e-49|57.6|132/0|b.1.18.2|1/1|E set domains| HM:SCP:REP 141->581|1bf2A3|7e-129|38.2|435/0|c.1.8.1|1/1|(Trans)glycosidases| HM:SCP:REP 590->700|1bf2A2|1.3e-26|48.0|102/0|b.71.1.1|1/1|Glycosyl hydrolase domain| OP:NHOMO 1359 OP:NHOMOORG 644 OP:PATTERN -------222222222------------------------------1---11---------------- 234--13222213-13422-23--2322222233332333433333421432334313---1424--46314333222----2-1---2221---1---211-113-431111111111111112---------1-55511---21-2724421111-12112-2-22253212111111111422------1-222221221222222-222-2222-11-134--------1--------------------1--11---------1----------222222221122222222222111111111111133211-33313--12-------2-1--1112322--21-13------1-21-1---3-1-1-4----------223322234333------------34433333322-1223434433332-1---2244441--33333333222-3235-------------------------------1----2223222-22422223334222221223322---2231-3---1-34---213-2---------113331111--21-111111-423-111-223325514-----------------------11113234-32-2-421122-1-111111-21-----31-2------13221111111111111-11111111111111111112222211-333333333333333211111111--222222222222-------------2-1-2222111-11111111----------32333333334333233331111111111122323232333222-33333333------1---------------1-2----------1-----2---1----122221211125- ----1------1--3-1-11--1----------111-111111-----11----11--1---1---------1--------11111---1211111111----111--------------------------------------------------1------1----------14365n444344647174------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 695 STR:RPRED 98.3 SQ:SECSTR ####HHHHccccccEEEEcccEEEEEEEcTTccEEEEEEEcTTcccEEEEcEEcGGGEEEEEEEcccTTcEEEEEEEETEEcccTTccTEEEEEccTTcccccGGGccEccccGGGGcccTTTTTcccTTTcccEccccccccccccccccccGGGccEEEEcHHHHHHcTTcccccTTcGGGGGcTTcHHHHHHHHTccEEEEcccEEEcccccTTcGGGcccccccEEEEEEEccTTcccccHHHHHHHHHHHHHHHHHTTcEEEEEEcTTccccGGGcHHHHHcTTTcccccccHcccTTcccccTTcccccccTTcHHHHHHHHHHHHHHHHHHcccEEEETTGGGccHHHHHHHHHHHHHHcTTcEEEEccccccccccGGGcccGGGGGGcTTcEEEcHHHHHHHHcccccTTcHTcccGGGTcGGGHHHHHHHHcTTcccTTcccccccGGGEEEcccccccccHHHHHHHHcTTccHHcccEEEEccEEEEEHHHHHHHHHHHHHHTcccEEEEETTGGGTcccTTccccTTccHHHHcccHHHHHHTHHHHHHHHHHHHHHHHcGGGcccccccTHHHHHHHHcGGGGcccHHHHHHHEEEEEEcccEEEEEEccGGGTEcEcTTTccccEEEEEEEccccEEEEEcccccccccEEEEEETTEEEEEEEcccEEccEEEEEccEEEEEE######## DISOP:02AL 1-3, 705-707| PSIPRED cccccccccccccccEEEccccEEEEEEcccccEEEEEEEcccccccEEccccccccEEEEEEcccccccEEEEEEEccccccccccccccEEEEccccEEEEcccccccccccccccccccccccccccccccEEEEcccccccccccccccccccEEEEEccccccccccccccccccccccHHHHHHHHHHHHccccEEEEccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccEEEEEEccccccccccccccccccccccccEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEcHHHHHcccccccccHHHHHHHHHHccccccEEEEEcccccccccHHHccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccHHcccHHHHcccccHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEccEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEccccccccccccccccEEEEEEEEcccccccccccccccccEEEEEEEcccccEEEEccccccccEEEEEEcccccccccccEEccccEEEEccHHHHHHHHHHHcccc //