[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55929.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  14/68 : Bacteria  121/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:233 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   30->192 2vxhF PDBj 9e-11 26.2 %
:RPS:PDB   19->232 3dtzB PDBj 4e-53 19.7 %
:RPS:SCOP  18->232 1t0tV  d.58.4.10 * 1e-57 22.7 %
:HMM:SCOP  6->234 1vdhA_ d.58.4.10 * 8.1e-76 44.1 %
:RPS:PFM   51->220 PF06778 * Chlor_dismutase 9e-30 40.5 %
:HMM:PFM   34->220 PF06778 * Chlor_dismutase 2.5e-63 41.2 187/193  
:BLT:SWISS 22->199 Y358_STAES 4e-14 28.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55929.1 GT:GENE AAZ55929.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2220824..2221525) GB:FROM 2220824 GB:TO 2221525 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ55929.1 GB:DB_XREF GI:71916027 LENGTH 233 SQ:AASEQ MSTETTTPDVEELNKLIRYTMWSVFRIGDITALDRAAAGDELTGLLDAAAEKGTATRGVYDVQGFRADADVMFWWIADTPEQLQTIYADFRRTALGRASTPVWSAIGIHRPAEFNRGHVPAFLAGEEPREYLCVYPFVRSYEWYLLPEEERRQMLAEHGRMAAPFPDVRANTVSTFGLSDYEWLLGFEANELHRIVDLVRALRAAQARRHTRLEIPFFTGKRKSVAELVEALP GT:EXON 1|1-233:0| BL:SWS:NREP 1 BL:SWS:REP 22->199|Y358_STAES|4e-14|28.2|174/249| SEG 200->209|ralraaqarr| BL:PDB:NREP 1 BL:PDB:REP 30->192|2vxhF|9e-11|26.2|160/229| RP:PDB:NREP 1 RP:PDB:REP 19->232|3dtzB|4e-53|19.7|208/213| RP:PFM:NREP 1 RP:PFM:REP 51->220|PF06778|9e-30|40.5|168/184|Chlor_dismutase| HM:PFM:NREP 1 HM:PFM:REP 34->220|PF06778|2.5e-63|41.2|187/193|Chlor_dismutase| RP:SCP:NREP 1 RP:SCP:REP 18->232|1t0tV|1e-57|22.7|211/243|d.58.4.10| HM:SCP:REP 6->234|1vdhA_|8.1e-76|44.1|227/0|d.58.4.10|1/1|Dimeric alpha+beta barrel| OP:NHOMO 138 OP:NHOMOORG 135 OP:PATTERN ------1111111111---------------------------------------------1-1--11 ----111111111111111-1111111111111111114111111111111-1111111111111111111-----------1--------------------------------------------------------11---11-------------------------------------111-------11111111111111111-1111111-------111111---11111111111111111-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 214 STR:RPRED 91.8 SQ:SECSTR ##################EEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHcTTccEEEEEEEccTTccEEEEEEEccHHHHHHHHHHHHHHHHTTTEEEEEEccEEEccTTTcccHHHHHHHHcccccEEEEEEEEEcHHHHHccHHHHHHHHHHHHHHTcGGTTcEEEEEEcTTTccccEEEEEEEccHHHHHHHHHHHTTcGGGGGEEcccccEEEEEEcTTTHHHHH# DISOP:02AL 1-3| PSIPRED cccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEEEcccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEcccccccccccHHHcccccccEEEEEEEEccHHHccccHHHHHHHHHHHHHHHHccccHHHEEEEEEEcccHHEEHEEccccHHHHHHHHHHHccHHHHHEEEEcccEEEEEcccHHHHHHHcc //