[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55933.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  66/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:193 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   11->183 PF11452 * DUF3000 3e-41 57.0 %
:HMM:PFM   10->184 PF11452 * DUF3000 5.8e-73 57.5 174/177  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55933.1 GT:GENE AAZ55933.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 2225313..2225894 GB:FROM 2225313 GB:TO 2225894 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ55933.1 GB:DB_XREF GI:71916031 LENGTH 193 SQ:AASEQ MPPHSRSDEAPPAFLRAVQSLHTRTVRPEIVVEDIPAPRRLAPYTVAMAATVHTDEGDAAFGRLIVLYDPEESRGWPGPFRMVAYVSAELEPDLSGDPLLGQVAWSWLTEALEAQGADHRALSGTVTRATTEGFGLKAGEPTTTEVEVRASWTPTEAEDLSAHRAAWLDLLSVAAGLPPVDVTDISRRARSDA GT:EXON 1|1-193:0| RP:PFM:NREP 1 RP:PFM:REP 11->183|PF11452|3e-41|57.0|172/177|DUF3000| HM:PFM:NREP 1 HM:PFM:REP 10->184|PF11452|5.8e-73|57.5|174/177|DUF3000| OP:NHOMO 66 OP:NHOMOORG 66 OP:PATTERN -------------------------------------------------------------------- ----111111111111111-111111111111111111111111111111111111111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10, 185-193| PSIPRED cccccccccccHHHHHHHHHHHHcEEccccEEEccccccccccEEEEEEEEEccccccccEEEEEEEEcccccccccccEEEEEEEEccccHHHccccccHHHHHHHHHHHHHHccccccccccEEEEEEEEccccccccccccEEEEEEEEcccccccHHHHHHHHHHHHHHHcccccccHHHccccccccc //