[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55938.1
DDBJ      :             putative regulatory protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:141 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55938.1 GT:GENE AAZ55938.1 GT:PRODUCT putative regulatory protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(2231817..2232242) GB:FROM 2231817 GB:TO 2232242 GB:DIRECTION - GB:PRODUCT putative regulatory protein GB:PROTEIN_ID AAZ55938.1 GB:DB_XREF GI:71916036 LENGTH 141 SQ:AASEQ MERARVLDDPEKTLDIVLGEPVLYARICPSRVMVGRLDRIVELIARKGTVIGIVPLHVRLPAIPEHGFWIFDDDRVNVETIGAELSLTDHNAIEPYRRVFAELSRAALRRQAALRLVARARYQLVPDRTGMEDGNAPTSRT GT:EXON 1|1-141:0| SEG 105->125|raalrrqaalrlvararyqlv| OP:NHOMO 8 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ------------------------------------2-----------------------1-------131---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 132-141| PSIPRED ccHHHcccccccEEEEEEcccEEEEEcccHHHHHHHHHHHHHHHHccccEEEEEEccccccccccccEEEEEccEEEEEEcccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccccccccccc //