[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55942.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.111.1c.52.1
:44 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->32 3h9qD PDBj 4e-07 59.4 %
:BLT:PDB   4->44 1yovD PDBj 1e-04 46.3 %
:RPS:PDB   1->32 3cmmA PDBj 2e-06 43.8 %
:RPS:SCOP  4->32 1bamA  c.52.1.3 * 6e-04 3.4 %
:HMM:SCOP  4->32 1yovB1 c.111.1.2 * 3e-07 69.0 %
:RPS:PFM   4->42 PF00899 * ThiF 7e-08 56.4 %
:HMM:PFM   3->32 PF00899 * ThiF 3.8e-12 63.3 30/136  
:BLT:SWISS 4->32 UBE13_WHEAT 1e-05 65.5 %
:BLT:SWISS 4->44 UBA3_DROME 2e-05 51.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55942.1 GT:GENE AAZ55942.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 2234000..2234134 GB:FROM 2234000 GB:TO 2234134 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ55942.1 GB:DB_XREF GI:71916040 InterPro:IPR000594 LENGTH 44 SQ:AASEQ MSVNLATAGVGQVTLVDSDLIEKSNLTRQYLFIGAESVDPNARF GT:EXON 1|1-44:0| BL:SWS:NREP 2 BL:SWS:REP 4->32|UBE13_WHEAT|1e-05|65.5|29/1053| BL:SWS:REP 4->44|UBA3_DROME|2e-05|51.2|41/450| BL:PDB:NREP 2 BL:PDB:REP 1->32|3h9qD|4e-07|59.4|32/333| BL:PDB:REP 4->44|1yovD|1e-04|46.3|41/382| RP:PDB:NREP 1 RP:PDB:REP 1->32|3cmmA|2e-06|43.8|32/1001| RP:PFM:NREP 1 RP:PFM:REP 4->42|PF00899|7e-08|56.4|39/135|ThiF| HM:PFM:NREP 1 HM:PFM:REP 3->32|PF00899|3.8e-12|63.3|30/136|ThiF| GO:PFM:NREP 1 GO:PFM GO:0003824|"GO:catalytic activity"|PF00899|IPR000594| RP:SCP:NREP 1 RP:SCP:REP 4->32|1bamA|6e-04|3.4|29/200|c.52.1.3| HM:SCP:REP 4->32|1yovB1|3e-07|69.0|29/0|c.111.1.2|1/1|Activating enzymes of the ubiquitin-like proteins| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 44 STR:RPRED 100.0 SQ:SECSTR HHHTTTccTTcEEEEEccccccGGGTTTcTTcTTccHHHHHHHH DISOP:02AL 41-44| PSIPRED ccEEEccccccEEEEEEccEEEEcccEEEEEEEEcccccccccc //